OPENSEQ.org - YAJQ - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YAJQ - UPF0234 protein YajQ

UniProt:	P0A8E7	Sequence MPSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEASFELNDASKTIKVLSESDFQVNQLLDILRAKLLKRGIEGSSLDVPENIVHSGKTWFVEAKLKQGIESATQKKIVKMIKDSKLKVQAQIQGDEIRVTGKSRDDLQAVMAMVRGGDLGQPFQFKNFRD	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13613
Length:	163 (163)
Sequences:	592
Seq/Len:	3.63

YAJQ
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
37_A	52_S	3.587	1.00
14_E	72_R	2.938	1.00
147_V	156_F	2.918	1.00
111_V	123_A	2.824	1.00
114_I	143_V	2.771	1.00
82_P	97_K	2.428	1.00
103_E	106_T	2.426	1.00
10_V	98_L	2.291	1.00
54_S	57_Q	2.2	1.00
111_V	130_I	2.189	1.00
80_D	99_K	1.934	1.00
113_M	150_G	1.904	1.00
69_L	79_L	1.873	1.00
110_I	130_I	1.868	1.00
113_M	152_L	1.821	0.99
19_V	65_L	1.787	0.99
16_R	20_D	1.778	0.99
117_S	146_M	1.774	0.99
129_E	159_K	1.761	0.99
58_V	94_V	1.716	0.99
21_N	68_K	1.645	0.99
69_L	74_I	1.644	0.99
13_Q	16_R	1.605	0.98
6_I	147_V	1.596	0.98
111_V	115_K	1.537	0.98
39_F	61_L	1.518	0.97
106_T	109_K	1.514	0.97
22_A	39_F	1.5	0.97
25_E	68_K	1.489	0.97
123_A	130_I	1.462	0.96
79_L	96_A	1.46	0.96
2_P	122_Q	1.455	0.96
84_N	92_W	1.454	0.96
112_K	116_D	1.453	0.96
24_R	127_G	1.374	0.94
55_D	71_K	1.368	0.94
144_M	158_F	1.348	0.94
80_D	97_K	1.329	0.93
87_H	93_F	1.307	0.92
139_D	142_A	1.291	0.92
32_F	57_Q	1.264	0.90
50_V	58_V	1.246	0.90
52_S	91_T	1.18	0.86
2_P	134_G	1.163	0.85
2_P	137_R	1.161	0.85
114_I	132_V	1.141	0.83
115_K	122_Q	1.129	0.82
145_A	149_G	1.129	0.82
7_V	159_K	1.127	0.82
19_V	41_L	1.117	0.81
25_E	72_R	1.109	0.81
20_D	24_R	1.101	0.80
23_S	38_S	1.101	0.80
64_I	68_K	1.093	0.79
39_F	65_L	1.092	0.79
12_L	69_L	1.084	0.79
126_Q	129_E	1.083	0.79
46_K	100_Q	1.075	0.78
106_T	153_G	1.067	0.77
135_K	139_D	1.064	0.77
75_E	155_P	1.063	0.77
15_A	69_L	1.056	0.76
20_D	57_Q	1.047	0.75
104_S	115_K	1.034	0.74
73_G	148_R	1.018	0.72
9_E	159_K	1.016	0.72
70_L	76_G	1.01	0.71
137_R	161_F	1.009	0.71
56_F	60_Q	1.004	0.71
84_N	94_V	1.004	0.71
14_E	25_E	1.003	0.71
30_F	66_R	1	0.70

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1in0A	2	1	100	0.016	Contact Map	0.722
4k3lA	2	0.7546	14.6	0.961	Contact Map	0.265
1tv8A	2	0.8957	13.7	0.961	Contact Map	0.315
1yj7A	4	0.4049	12.9	0.961	Contact Map	0.823
2y9jY	24	0.3926	12.7	0.961	Contact Map	0.86
3eikA	2	0.9387	11.1	0.963	Contact Map	0.308
1vpkA	1	0.7485	9.8	0.963	Contact Map	0.355
4djgA	2	0.3129	8.9	0.964	Contact Map	0.373
2avtA	2	0.7546	8.7	0.964	Contact Map	0.264
1mp9A	2	0.5153	8.3	0.965	Contact Map	0.459

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0183 seconds.