OPENSEQ.org - RIMP - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

RIMP - Ribosome maturation factor RimP

UniProt:	P0A8A8	Sequence MSTLEQKLTEMITAPVEALGFELVGIEFIRGRTSTLRIYIDSEDGINVDDCADVSHQVSAVLDVEDPITVAYNLEVSSPGLDRPLFTAEHYARFVGEEVTLVLRMAVQNRRKWQGVIKAVDGEMITVTVEGKDEVFALSNIQKANLVPHF	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11179
Length:	150 (150)
Sequences:	1511
Seq/Len:	10.07

RIMP
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
88_A	138_L	2.597	1.00
137_A	140_N	2.527	1.00
124_M	135_V	2.502	1.00
16_V	54_V	2.498	1.00
28_F	36_L	2.483	1.00
13_T	17_E	2.436	1.00
38_I	58_V	2.411	1.00
25_G	86_F	2.361	1.00
40_I	54_V	2.222	1.00
118_K	128_T	2.123	1.00
103_L	113_W	2.016	1.00
120_V	138_L	1.885	1.00
24_V	90_H	1.882	1.00
87_T	90_H	1.799	1.00
27_E	37_R	1.78	1.00
98_E	149_H	1.749	1.00
98_E	116_V	1.739	1.00
39_Y	77_S	1.729	1.00
94_F	146_L	1.723	1.00
12_I	58_V	1.681	1.00
16_V	23_L	1.646	1.00
52_A	56_H	1.638	1.00
21_F	46_I	1.614	1.00
47_N	50_D	1.563	1.00
121_D	124_M	1.51	1.00
89_E	92_A	1.508	1.00
118_K	133_D	1.481	1.00
95_V	119_A	1.469	1.00
46_I	78_S	1.466	1.00
54_V	58_V	1.406	0.99
40_I	46_I	1.402	0.99
119_A	126_T	1.391	0.99
41_D	46_I	1.386	0.99
51_C	55_S	1.382	0.99
36_L	62_L	1.365	0.99
100_T	112_K	1.358	0.99
7_K	10_E	1.342	0.99
42_S	50_D	1.34	0.99
141_I	144_A	1.339	0.99
126_T	135_V	1.338	0.99
24_V	94_F	1.321	0.99
88_A	123_E	1.32	0.99
9_T	13_T	1.302	0.99
126_T	133_D	1.284	0.99
116_V	128_T	1.283	0.99
27_E	39_Y	1.282	0.99
22_E	89_E	1.269	0.99
55_S	59_S	1.257	0.99
24_V	84_P	1.254	0.99
79_P	83_R	1.242	0.98
36_L	72_Y	1.213	0.98
104_R	142_Q	1.197	0.98
16_V	19_L	1.189	0.98
99_V	117_I	1.184	0.98
19_L	53_D	1.18	0.98
125_I	141_I	1.174	0.98
28_F	70_V	1.167	0.97
6_Q	9_T	1.154	0.97
9_T	87_T	1.153	0.97
88_A	120_V	1.15	0.97
61_V	65_E	1.15	0.97
18_A	57_Q	1.144	0.97
61_V	64_V	1.142	0.97
4_L	8_L	1.136	0.97
118_K	126_T	1.125	0.97
99_V	144_A	1.121	0.97
49_D	52_A	1.112	0.96
123_E	139_S	1.107	0.96
33_T	73_N	1.102	0.96
115_G	127_V	1.083	0.96
21_F	50_D	1.076	0.95
91_Y	144_A	1.065	0.95
90_H	93_R	1.064	0.95
59_S	63_D	1.061	0.95
19_L	57_Q	1.051	0.94
128_T	131_G	1.047	0.94
15_P	54_V	1.041	0.94
41_D	93_R	1.035	0.94
34_S	70_V	1.022	0.93
95_V	120_V	1.015	0.93
51_C	78_S	1.004	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1ib8A	1	0.9933	100	0.025	Contact Map	0.534
3pgwB	2	0.4267	78.1	0.901	Contact Map	0.044
4c92A	1	0.46	53.5	0.916	Contact Map	0.626
4m7dA	2	0.4	44.3	0.92	Contact Map	0.826
4m77A	2	0.4	43.5	0.921	Contact Map	0.786
4c92C	1	0.42	40.3	0.922	Contact Map	0.892
1i8fA	7	0.46	37.4	0.924	Contact Map	0.841
4f7uF	2	0.44	36.2	0.924	Contact Map	0.896
1ycyA	4	0.4267	36	0.925	Contact Map	0.77
1y96A	2	0.4467	33.8	0.925	Contact Map	0.751

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.3423 seconds.