OPENSEQ.org - RECR - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

RECR - Recombination protein RecR

UniProt:	P0A7H6	Sequence MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10834
Length:	201 (195)
Sequences:	1385
Seq/Len:	7.10

RECR
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
58_A	67_E	4.007	1.00
80_N	104_R	3.921	1.00
167_E	198_K	3.279	1.00
124_G	127_R	3.021	1.00
140_V	161_C	3.001	1.00
81_G	138_T	2.861	1.00
49_R	53_E	2.836	1.00
20_V	28_M	2.746	1.00
144_T	154_A	2.545	1.00
58_A	68_V	2.508	1.00
175_V	184_V	2.488	1.00
24_S	28_M	2.241	1.00
14_L	32_L	2.218	1.00
83_I	137_I	2.199	1.00
132_L	161_C	2.176	1.00
14_L	29_A	2.136	1.00
125_L	157_I	2.103	1.00
113_S	116_D	2.102	1.00
66_Q	73_S	2.063	1.00
61_R	124_G	2.037	1.00
45_Q	48_T	2.021	1.00
61_R	127_R	2.016	1.00
59_D	68_V	1.964	1.00
14_L	43_L	1.931	1.00
125_L	129_E	1.879	1.00
40_G	47_L	1.869	1.00
130_Q	133_A	1.805	1.00
101_F	104_R	1.723	1.00
40_G	51_M	1.716	1.00
79_E	138_T	1.702	1.00
36_D	39_G	1.686	1.00
130_Q	134_E	1.661	1.00
41_M	52_S	1.659	1.00
129_E	132_L	1.651	1.00
41_M	48_T	1.626	1.00
45_Q	49_R	1.55	1.00
141_I	193_L	1.523	0.99
55_G	67_E	1.503	0.99
169_S	198_K	1.502	0.99
106_F	131_R	1.498	0.99
59_D	135_E	1.488	0.99
79_E	82_Q	1.449	0.99
37_R	52_S	1.428	0.99
44_A	48_T	1.398	0.99
37_R	41_M	1.397	0.99
97_Q	186_G	1.355	0.98
8_T	12_E	1.355	0.98
87_E	111_H	1.339	0.98
126_D	130_Q	1.307	0.98
119_G	122_D	1.298	0.98
40_G	43_L	1.264	0.97
112_L	152_A	1.251	0.97
95_I	193_L	1.242	0.97
165_D	168_A	1.207	0.96
9_Q	49_R	1.198	0.96
185_D	188_T	1.183	0.95
74_N	102_S	1.179	0.95
173_H	191_H	1.174	0.95
32_L	35_R	1.171	0.95
11_M	141_I	1.169	0.95
132_L	166_V	1.156	0.95
176_P	179_G	1.155	0.95
123_I	157_I	1.155	0.95
96_E	105_Y	1.142	0.94
89_P	92_I	1.126	0.94
112_L	148_V	1.121	0.93
160_L	163_Q	1.12	0.93
56_H	109_M	1.119	0.93
22_P	179_G	1.113	0.93
6_L	54_I	1.083	0.92
34_Q	88_S	1.08	0.92
10_L	50_A	1.077	0.91
23_K	40_G	1.066	0.91
61_R	109_M	1.059	0.91
132_L	136_K	1.057	0.90
176_P	188_T	1.055	0.90
111_H	147_T	1.029	0.89
151_E	155_N	1.027	0.89
13_A	16_C	1.026	0.89

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3vdpA	4	0.9851	100	0.039	Contact Map	0.875
1vddA	4	0.9851	100	0.068	Contact Map	0.779
2gaiA	2	0.5771	95.8	0.916	Contact Map	0.508
1mw9X	1	0.5821	95.6	0.917	Contact Map	0.463
1i7dA	1	0.5622	94.2	0.923	Contact Map	0.476
2fcjA	3	0.5423	93.6	0.925	Contact Map	0.602
1gkuB	1	0.9453	92.8	0.927	Contact Map	0.39
4dduA	1	0.8905	90.8	0.931	Contact Map	0.36
4gfjA	1	0.9303	89.7	0.933	Contact Map	0.282
1yuzA	2	0.393	84.3	0.938	Contact Map	0.26

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0151 seconds.