OPENSEQ.org - MINE - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

MINE - Cell division topological specificity factor

UniProt:	P0A734	Sequence MALLDFFLSRKKNTANIAKERLQIIVAERRRSDAEPHYLPQLRKDILEVICKYVQIDPEMVTVQLEQKDGDISILELNVTLPEAEELK	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10598
Length:	88 (84)
Sequences:	490
Seq/Len:	5.83

MINE
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
44_K	48_E	2.795	1.00
42_L	45_D	2.324	1.00
73_S	79_V	1.828	1.00
5_D	8_L	1.822	1.00
11_K	52_K	1.822	1.00
25_I	65_L	1.693	1.00
48_E	52_K	1.691	1.00
57_D	60_M	1.585	0.99
77_L	80_T	1.519	0.99
41_Q	45_D	1.505	0.99
15_A	18_A	1.463	0.99
42_L	46_I	1.418	0.98
29_R	77_L	1.37	0.98
57_D	68_K	1.362	0.98
46_I	68_K	1.321	0.97
50_I	73_S	1.295	0.97
51_C	58_P	1.271	0.96
33_D	84_A	1.247	0.95
43_R	64_Q	1.238	0.95
6_F	9_S	1.226	0.95
2_A	29_R	1.182	0.93
25_I	53_Y	1.169	0.93
20_E	23_Q	1.168	0.93
39_L	61_V	1.162	0.93
14_T	83_E	1.161	0.93
56_I	60_M	1.138	0.92
20_E	30_R	1.132	0.91
15_A	76_E	1.123	0.91
26_V	80_T	1.119	0.91
73_S	80_T	1.105	0.90
30_R	54_V	1.094	0.89
47_L	50_I	1.079	0.88
46_I	73_S	1.075	0.88
26_V	67_Q	1.075	0.88
16_N	20_E	1.07	0.88
29_R	37_H	1.058	0.87
27_A	50_I	1.057	0.87
4_L	65_L	1.05	0.87
8_L	61_V	1.049	0.87
29_R	45_D	1.038	0.86
29_R	43_R	1.025	0.85
7_F	64_Q	1.019	0.84
24_I	77_L	1.005	0.83
25_I	74_I	1.004	0.83

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2kxoA	2	0.9773	100	0.07	Contact Map	0.254
3ku7A	2	0.8636	99.9	0.188	Contact Map	0.234
3r9jC	2	0.875	99.9	0.208	Contact Map	0.21
3epsA	2	0.9318	11.6	0.908	Contact Map	0.271
3v2cY	1	0.7045	7.7	0.916	Contact Map	0.144
3tqmA	4	0.7045	7.2	0.917	Contact Map	0.214
2au3A	1	0.5909	7.2	0.917	Contact Map	0.001
1imuA	1	0.7045	6.9	0.917	Contact Map	0.111
3v26X	1	0.7045	6.8	0.918	Contact Map	0.121
4fylA	2	0.7045	6.4	0.919	Contact Map	0.182

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0506 seconds.