OPENSEQ.org - DTD - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

DTD - D-tyrosyl-tRNA(Tyr) deacylase

UniProt:	P0A6M4	Sequence MIALIQRVTRASVTVEGEVTGEIGAGLLVLLGVEKDDDEQKANRLCERVLGYRIFSDAEGKMNLNVQQAGGSVLVVSQFTLAADTERGMRPSFSKGASPDRAEALYDYFVERCRQQEMNTQTGRFAADMQVSLVNDGPVTFWLQV	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11852
Length:	145 (145)
Sequences:	1581
Seq/Len:	10.90

DTD
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
10_R	132_S	2.998	1.00
110_V	122_T	2.481	1.00
43_N	112_R	2.439	1.00
4_L	142_W	2.393	1.00
15_V	20_T	2.39	1.00
42_A	108_Y	2.333	1.00
18_E	124_R	2.281	1.00
65_N	68_Q	2.28	1.00
27_L	54_I	2.247	1.00
103_E	107_D	2.203	1.00
39_E	108_Y	2.179	1.00
75_V	110_V	2.162	1.00
20_T	124_R	2.122	1.00
3_A	29_V	2.014	1.00
11_A	28_L	2.003	1.00
38_D	41_K	1.963	1.00
51_G	89_M	1.95	1.00
10_R	134_V	1.902	1.00
75_V	109_F	1.884	1.00
101_R	104_A	1.849	1.00
21_G	121_Q	1.828	1.00
28_L	133_L	1.822	1.00
12_S	132_S	1.801	1.00
9_T	130_Q	1.799	1.00
34_E	82_A	1.777	1.00
3_A	31_L	1.744	1.00
27_L	66_V	1.727	1.00
112_R	115_Q	1.718	1.00
8_V	28_L	1.68	1.00
46_C	113_C	1.653	1.00
41_K	145_V	1.615	1.00
14_T	19_V	1.531	1.00
66_V	73_V	1.463	1.00
2_I	144_Q	1.44	1.00
13_V	131_V	1.425	1.00
62_M	139_V	1.423	1.00
77_S	106_Y	1.397	0.99
14_T	132_S	1.351	0.99
57_D	63_N	1.347	0.99
130_Q	136_D	1.335	0.99
73_V	113_C	1.321	0.99
61_K	93_F	1.321	0.99
111_E	114_R	1.317	0.99
35_K	95_K	1.311	0.99
3_A	49_V	1.293	0.99
19_V	22_E	1.292	0.99
47_E	51_G	1.292	0.99
83_A	141_F	1.277	0.99
75_V	106_Y	1.264	0.99
29_V	49_V	1.264	0.99
85_T	143_L	1.226	0.98
66_V	118_M	1.201	0.98
56_S	93_F	1.193	0.98
43_N	108_Y	1.185	0.98
42_A	105_L	1.185	0.98
58_A	64_L	1.182	0.98
42_A	45_L	1.181	0.98
2_I	142_W	1.174	0.98
30_L	133_L	1.163	0.97
75_V	113_C	1.159	0.97
11_A	133_L	1.153	0.97
114_R	122_T	1.15	0.97
130_Q	134_V	1.146	0.97
36_D	101_R	1.142	0.97
24_G	72_S	1.135	0.97
28_L	76_V	1.133	0.97
41_K	44_R	1.116	0.96
111_E	115_Q	1.106	0.96
6_Q	133_L	1.105	0.96
50_L	118_M	1.096	0.96
103_E	124_R	1.093	0.96
29_V	75_V	1.091	0.96
35_K	98_S	1.059	0.95
35_K	97_A	1.055	0.95
66_V	71_G	1.042	0.94
31_L	109_F	1.038	0.94
108_Y	112_R	1.031	0.94
9_T	134_V	1.03	0.94
39_E	43_N	1.03	0.94
39_E	104_A	1.025	0.93
21_G	74_L	1.014	0.93
47_E	116_Q	1.009	0.93
101_R	105_L	1.008	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2dboA	1	1	100	0.02	Contact Map	0.745
1jkeA	4	1	100	0.021	Contact Map	0.901
1j7gA	1	0.9931	100	0.029	Contact Map	0.756
2okvA	4	0.9931	100	0.038	Contact Map	0.837
3ko5A	6	1	100	0.04	Contact Map	0.783
1tc5A	4	0.9862	100	0.126	Contact Map	0.667
2g5xA	1	0.3586	54.2	0.941	Contact Map	0.333
3bidA	8	0.4345	49.6	0.942	Contact Map	0.119
2k49A	1	0.6483	30.6	0.949	Contact Map	0.115
3if8A	1	0.3862	23.2	0.952	Contact Map	0.251

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0456 seconds.