OPENSEQ.org - ARGR - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

ARGR - Arginine repressor

UniProt:	P0A6D0	Sequence MRSSAKQEELVKAFKALLKEEKFSSQGEIVAALQEQGFDNINQSKVSRMLTKFGAVRTRNAKMEMVYCLPAELGVPTTSSPLKNLVLDIDYNDAVVVIHTSPGAAQLIARLLDSLGKAEGILGTIAGDDTIFTTPANGFTVKDLYEAILELFDQEL	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10070
Length:	156 (146)
Sequences:	842
Seq/Len:	5.77

ARGR
Paralog alert: 0.39 [within 20: 0.02] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
21_E	32_A	3.396	1.00
90_D	136_A	3.04	1.00
93_D	138_G	2.54	1.00
23_F	32_A	2.423	1.00
13_A	36_Q	2.354	1.00
13_A	38_F	2.192	1.00
112_L	148_I	2.116	1.00
17_L	32_A	1.848	1.00
13_A	16_A	1.824	1.00
14_F	23_F	1.772	1.00
32_A	35_E	1.698	1.00
50_L	55_A	1.663	1.00
137_N	140_T	1.595	0.99
135_P	141_V	1.589	0.99
135_P	144_L	1.576	0.99
10_L	49_M	1.543	0.99
113_D	127_G	1.496	0.99
100_T	127_G	1.493	0.99
105_A	129_D	1.472	0.99
113_D	124_T	1.441	0.98
92_N	122_L	1.438	0.98
30_V	46_V	1.424	0.98
25_S	50_L	1.407	0.98
22_K	66_V	1.371	0.98
100_T	105_A	1.371	0.98
7_Q	10_L	1.345	0.97
23_F	29_I	1.342	0.97
15_K	69_L	1.338	0.97
102_P	129_D	1.324	0.97
7_Q	11_V	1.305	0.97
51_T	65_M	1.303	0.97
113_D	123_G	1.3	0.97
58_T	68_C	1.288	0.96
120_G	147_A	1.283	0.96
110_R	129_D	1.277	0.96
142_K	146_E	1.272	0.96
113_D	130_T	1.266	0.96
41_I	46_V	1.254	0.96
27_G	57_R	1.251	0.95
95_V	134_T	1.249	0.95
140_T	143_D	1.236	0.95
126_A	131_I	1.22	0.95
127_G	130_T	1.22	0.95
46_V	104_A	1.219	0.95
102_P	128_D	1.202	0.94
7_Q	52_K	1.201	0.94
31_A	34_Q	1.193	0.94
105_A	113_D	1.169	0.93
30_V	41_I	1.159	0.92
96_V	145_Y	1.159	0.92
89_I	98_I	1.146	0.92
109_A	126_A	1.141	0.92
112_L	121_I	1.141	0.92
86_V	98_I	1.138	0.91
141_V	145_Y	1.136	0.91
25_S	55_A	1.129	0.91
92_N	141_V	1.125	0.91
118_A	121_I	1.112	0.90
124_T	127_G	1.112	0.90
102_P	110_R	1.109	0.90
147_A	150_E	1.103	0.90
103_G	128_D	1.097	0.89
97_V	127_G	1.087	0.89
122_L	127_G	1.085	0.89
16_A	20_E	1.084	0.89
31_A	119_E	1.074	0.88
113_D	129_D	1.072	0.88
25_S	28_E	1.057	0.87
92_N	137_N	1.044	0.86
17_L	21_E	1.042	0.86
11_V	53_F	1.037	0.85
26_Q	43_Q	1.032	0.85
138_G	141_V	1.031	0.85
96_V	135_P	1.03	0.85
31_A	35_E	1.026	0.85
100_T	113_D	1.022	0.84
54_G	59_R	1.022	0.84
11_V	52_K	1.018	0.84
45_K	49_M	1.016	0.84
109_A	113_D	1.014	0.84
92_N	135_P	1.011	0.83
32_A	36_Q	1.007	0.83
42_N	49_M	1	0.83

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3v4gA	1	0.9872	100	0.044	Contact Map	0.473
3lapA	6	0.9615	100	0.087	Contact Map	0.653
1b4aA	6	0.9359	100	0.191	Contact Map	0.755
2p5mA	3	0.5321	99.9	0.55	Contact Map	0.663
2zfzA	6	0.5064	99.9	0.554	Contact Map	0.609
1xxaA	6	0.4936	99.9	0.56	Contact Map	0.593
1b4bA	3	0.4551	99.9	0.56	Contact Map	0.666
2p5kA	1	0.4103	99	0.753	Contact Map	0.818
2fu4A	2	0.4423	96.5	0.861	Contact Map	0.528
4l5jA	4	0.9103	96.3	0.864	Contact Map	0.363

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0867 seconds.