OPENSEQ.org - PRIB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

PRIB - Primosomal replication protein n

UniProt:	P07013	Sequence MTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSGD	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10764
Length:	104 (104)
Sequences:	176
Seq/Len:	1.69

PRIB
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
5_L	11_V	2.149	0.99
34_R	90_M	1.926	0.98
26_H	55_S	1.811	0.97
36_V	45_Q	1.758	0.96
74_V	92_L	1.697	0.95
9_G	31_L	1.679	0.94
50_M	70_S	1.653	0.94
53_I	62_I	1.574	0.91
40_A	93_H	1.55	0.90
9_G	52_V	1.51	0.89
37_Q	97_I	1.405	0.84
11_V	38_E	1.386	0.82
29_F	95_E	1.348	0.80
22_S	25_P	1.342	0.80
7_L	74_V	1.339	0.79
48_C	51_P	1.328	0.79
95_E	99_L	1.325	0.78
2_T	78_I	1.308	0.77
57_H	60_Q	1.306	0.77
64_H	97_I	1.306	0.77
59_N	62_I	1.304	0.77
9_G	34_R	1.273	0.74
33_H	41_G	1.245	0.72
29_F	100_I	1.199	0.68
18_K	22_S	1.184	0.66
1_M	22_S	1.182	0.66
9_G	20_S	1.179	0.66
44_R	93_H	1.175	0.66
79_S	83_A	1.173	0.65
84_K	103_G	1.164	0.64
48_C	95_E	1.163	0.64
17_R	27_C	1.16	0.64
38_E	43_H	1.135	0.62
1_M	84_K	1.134	0.61
15_P	94_A	1.132	0.61
53_I	93_H	1.126	0.61
36_V	41_G	1.115	0.60
17_R	46_A	1.097	0.58
32_E	47_W	1.096	0.58
19_V	79_S	1.093	0.57
39_E	93_H	1.086	0.57
89_K	92_L	1.084	0.56
6_V	75_Q	1.082	0.56
46_A	81_H	1.064	0.54
23_G	39_E	1.061	0.54
52_V	94_A	1.059	0.54
26_H	86_G	1.046	0.52
54_V	59_N	1.035	0.51
20_S	55_S	1.029	0.50
42_F	69_G	1.029	0.50
20_S	24_I	1.027	0.50
5_L	83_A	1.025	0.50
20_S	94_A	1.025	0.50
19_V	25_P	1.017	0.49
40_A	48_C	1.016	0.49
64_H	73_T	1.014	0.49
85_N	88_S	1.004	0.48
5_L	78_I	1.002	0.48

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1txyA	2	1	99.8	0.506	Contact Map	0.345
1v1qA	2	1	99.8	0.509	Contact Map	0.351
3fhwA	2	0.9615	99.7	0.538	Contact Map	0.352
3k8aA	2	0.9423	99.6	0.557	Contact Map	0.36
4fdbA	1	0.9712	99.6	0.568	Contact Map	0.329
1se8A	1	1	99.5	0.611	Contact Map	0.318
2vw9A	2	1	99.4	0.617	Contact Map	0.335
2fxqA	1	1	99.4	0.618	Contact Map	0.293
3vdyA	2	0.9808	99.4	0.621	Contact Map	0.329
3tqyA	4	1	99.4	0.63	Contact Map	0.349

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.3416 seconds.