OPENSEQ.org - PTHA - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

PTHA - Glucitol/sorbitol-specific phosphotransferase enzyme IIA component

UniProt:	P05706	Sequence MTVIYQTTITRIGASAIDALSDQMLITFREGAPADLEEYCFIHCHGELKGALHPGLQFSLGQHRYPVTAVGSVAEDNLRELGHVTLRFDGLNEAEFPGTVHVAGPVPDDIAPGSVLKFESVKE	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10970
Length:	123 (120)
Sequences:	238
Seq/Len:	1.98

PTHA
Paralog alert: 0.25 [within 20: 0.01] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
86_L	102_V	4.15	1.00
77_N	84_V	2.59	1.00
89_D	101_H	2.243	1.00
11_R	37_E	2.227	1.00
61_G	114_S	2.051	0.99
74_A	100_V	1.973	0.99
84_V	100_V	1.943	0.99
69_A	94_A	1.856	0.98
40_C	81_L	1.705	0.96
43_H	118_F	1.589	0.94
68_T	90_G	1.548	0.93
19_A	23_Q	1.498	0.91
90_G	94_A	1.491	0.91
14_A	38_E	1.473	0.90
35_D	85_T	1.451	0.89
27_T	116_L	1.435	0.88
56_L	67_V	1.424	0.88
22_D	85_T	1.402	0.87
66_P	100_V	1.368	0.85
52_L	74_A	1.363	0.85
39_Y	89_D	1.348	0.84
100_V	112_P	1.341	0.83
65_Y	88_F	1.325	0.82
87_R	99_T	1.312	0.81
69_A	90_G	1.307	0.81
8_T	115_V	1.302	0.81
29_R	43_H	1.294	0.80
39_Y	85_T	1.27	0.78
5_Y	27_T	1.254	0.77
22_D	39_Y	1.238	0.76
26_I	39_Y	1.221	0.74
27_T	86_L	1.214	0.74
19_A	103_A	1.205	0.73
1_M	4_I	1.179	0.71
9_I	25_L	1.178	0.71
54_P	115_V	1.168	0.70
62_Q	110_I	1.159	0.69
12_I	70_V	1.157	0.69
16_A	93_E	1.147	0.68
73_V	101_H	1.147	0.68
33_P	98_G	1.131	0.66
98_G	118_F	1.129	0.66
18_D	116_L	1.121	0.65
4_I	75_E	1.119	0.65
4_I	56_L	1.118	0.65
26_I	114_S	1.108	0.64
6_Q	117_K	1.083	0.61
25_L	110_I	1.082	0.61
74_A	101_H	1.073	0.60
101_H	104_G	1.07	0.60
59_S	117_K	1.069	0.60
54_P	70_V	1.038	0.56
67_V	114_S	1.009	0.53
73_V	77_N	1.001	0.52
24_M	114_S	1.001	0.52

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2f9hA	2	0.9919	100	0.06	Contact Map	0.422
2qqrA	2	0.7724	33.6	0.925	Contact Map	0.056
2xdpA	1	0.7967	25.6	0.929	Contact Map	0.095
4e0fA	3	0.748	13.4	0.938	Contact Map	0.338
3et6A	1	0.9106	12.9	0.938	Contact Map	0.097
2kl0A	1	0.4553	11.5	0.94	Contact Map	0.041
3ddyA	1	0.7073	11.3	0.94	Contact Map	0.282
1kzlA	1	0.7073	8.6	0.943	Contact Map	0.25
1iz6A	3	0.6504	8.3	0.943	Contact Map	0.277
2eifA	1	0.6992	8.2	0.944	Contact Map	0.107

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0429 seconds.