OPENSEQ.org - RS6 - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

RS6 - 30S ribosomal protein S6

UniProt:	P02358	Sequence MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANETADDAEAGDSEEEEEE	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10905
Length:	135 (111)
Sequences:	455
Seq/Len:	4.10

RS6
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
66_A	71_I	3.019	1.00
9_M	57_A	2.533	1.00
68_Q	72_D	2.477	1.00
29_I	34_G	2.402	1.00
30_T	35_K	2.315	1.00
67_P	70_V	1.842	1.00
32_A	67_P	1.82	1.00
26_T	30_T	1.766	0.99
44_R	59_Y	1.543	0.98
45_R	59_Y	1.536	0.98
51_I	86_R	1.505	0.98
30_T	76_T	1.485	0.97
35_K	65_E	1.455	0.97
32_A	70_V	1.448	0.97
29_I	90_M	1.324	0.94
67_P	71_I	1.311	0.94
9_M	30_T	1.308	0.94
7_V	61_L	1.293	0.93
29_I	68_Q	1.262	0.92
28_A	77_T	1.246	0.91
41_D	58_H	1.232	0.91
8_F	78_F	1.228	0.91
33_E	53_K	1.221	0.90
106_K	109_R	1.213	0.90
27_A	30_T	1.168	0.87
18_V	58_H	1.167	0.87
36_I	90_M	1.165	0.87
66_A	109_R	1.14	0.86
45_R	60_V	1.126	0.85
8_F	60_V	1.123	0.85
58_H	100_S	1.107	0.83
52_N	79_R	1.104	0.83
71_I	75_E	1.103	0.83
75_E	109_R	1.096	0.83
22_I	60_V	1.092	0.82
35_K	110_R	1.088	0.82
23_E	59_Y	1.084	0.82
27_A	31_G	1.079	0.81
91_R	94_H	1.077	0.81
30_T	94_H	1.075	0.81
70_V	74_L	1.074	0.81
26_T	39_L	1.061	0.80
29_I	70_V	1.059	0.80
28_A	70_V	1.057	0.79
31_G	85_I	1.045	0.78
105_A	108_E	1.045	0.78
12_P	78_F	1.044	0.78
99_A	103_V	1.044	0.78
56_K	100_S	1.043	0.78
75_E	89_V	1.042	0.78
9_M	92_T	1.041	0.78
40_E	100_S	1.039	0.78
29_I	110_R	1.038	0.78
9_M	91_R	1.029	0.77
37_H	65_E	1.028	0.77
27_A	69_E	1.022	0.76
37_H	63_N	1.013	0.75
40_E	58_H	1.011	0.75
1_M	7_V	1.011	0.75
1_M	5_E	1.008	0.75
27_A	84_V	1.007	0.75
26_T	36_I	1.007	0.75
74_L	78_F	1.005	0.74

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
4kiyF	1	1	100	0.184	Contact Map	0.418
1vmbA	1	0.8963	100	0.271	Contact Map	0.439
2j5aA	1	0.7556	100	0.296	Contact Map	0.464
1cqmA	2	0.7407	100	0.299	Contact Map	0.463
3r3tA	2	0.7037	100	0.302	Contact Map	0.246
3bbnF	1	0.7185	100	0.31	Contact Map	0.367
2kjwA	1	0.3926	99.8	0.571	Contact Map	0.418
3zzpA	1	0.5407	99.1	0.725	Contact Map	0.624
1dkgA	2	0.6889	18.9	0.935	Contact Map	0.127
4aniA	4	0.6593	15.8	0.937	Contact Map	0.078

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0363 seconds.