OPENSEQ.org - PINH - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

PINH - Putative DNA-invertase from prophage CP4-44 (Fragment)

UniProt:	P76611	Sequence NRGRRSGLKKLVRTSSAGNALLVCKLNRLGRSMWHLVVLLEELCERGINFRALAQSIFAQQWGDECCKSKTICDLKVIV	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14310
Length:	79 (68)
Sequences:	411
Seq/Len:	6.04

PINH
Paralog alert: 0.50 [within 20: 0.12] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
7_G	10_K	3.796	1.00
11_L	21_L	3.44	1.00
52_A	55_Q	2.666	1.00
43_L	48_I	2.12	1.00
5_R	31_R	1.763	1.00
42_E	46_R	1.748	1.00
8_L	39_L	1.571	0.99
8_L	36_L	1.506	0.99
17_A	47_G	1.492	0.99
10_K	14_T	1.431	0.99
34_W	38_V	1.396	0.98
15_S	48_I	1.369	0.98
11_L	15_S	1.357	0.98
15_S	21_L	1.321	0.97
33_M	37_V	1.287	0.97
24_C	54_A	1.262	0.96
9_K	12_V	1.194	0.94
9_K	39_L	1.19	0.94
4_R	9_K	1.188	0.94
38_V	41_E	1.166	0.93
3_G	40_L	1.161	0.93
10_K	13_R	1.146	0.92
30_G	37_V	1.129	0.92
21_L	43_L	1.125	0.92
65_E	69_S	1.116	0.91
61_Q	64_D	1.106	0.91
36_L	57_I	1.103	0.90
10_K	46_R	1.099	0.90
33_M	69_S	1.095	0.90
4_R	23_V	1.086	0.90
14_T	17_A	1.082	0.89
32_S	35_H	1.018	0.85
37_V	69_S	1.017	0.85
33_M	64_D	1.015	0.85
55_Q	66_C	1.001	0.84

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3uj3X	1	1	99.5	0.411	Contact Map	0.447
2gm5A	4	1	99.5	0.431	Contact Map	0.709
1gdtA	2	1	99.5	0.433	Contact Map	0.637
3pkzA	12	0.962	99.4	0.442	Contact Map	0.608
3g13A	2	1	99.4	0.448	Contact Map	0.652
2r0qC	4	1	99.4	0.46	Contact Map	0.621
3guvA	1	1	99.4	0.46	Contact Map	0.606
3bvpA	2	1	99.3	0.471	Contact Map	0.584
3lhkA	4	0.8987	99.3	0.493	Contact Map	0.685
4bqqA	2	1	99.2	0.504	Contact Map	0.635

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0181 seconds.