OPENSEQ.org - YFCR - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YFCR - Uncharacterized protein YfcR

UniProt:	P76501	Sequence MTGGVMSQKFVVGAGLLVCSVCSLSAMAGSKPVDLILRVLVDAPPPCSIKGSQVEFGNMIADNVDGTNYRQDAKYTLNCTNSLANDLRMQLKGNTSTINGETVLSTNITGLGIRIENSADNSLFAVGENSWTPFNINNQPQLKAVPVKASGAQLAAGEFNASLTMVVDYQ	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14121
Length:	170 (154)
Sequences:	203
Seq/Len:	1.32

YFCR
Paralog alert: 0.79 [within 20: 0.35] - ratio of genomes with paralogs
Cluster includes: YFCQ YFCR

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
37_L	41_V	2.84	1.00
89_M	165_M	2.357	0.99
61_A	64_V	2.03	0.98
110_G	149_A	1.947	0.97
65_D	146_P	1.782	0.94
66_G	146_P	1.615	0.89
96_S	112_G	1.609	0.89
99_N	111_L	1.597	0.88
75_Y	140_P	1.55	0.86
94_N	161_A	1.489	0.83
66_G	145_V	1.469	0.82
45_P	154_L	1.465	0.81
70_R	116_E	1.405	0.78
48_S	58_N	1.392	0.77
67_T	146_P	1.38	0.76
60_I	63_N	1.373	0.75
145_V	154_L	1.365	0.75
113_I	146_P	1.362	0.74
70_R	143_K	1.361	0.74
85_N	134_F	1.35	0.74
77_L	99_N	1.343	0.73
66_G	148_K	1.299	0.69
54_V	57_G	1.291	0.69
69_Y	136_I	1.29	0.69
143_K	165_M	1.289	0.69
59_M	71_Q	1.284	0.68
16_L	19_C	1.262	0.66
9_K	17_L	1.261	0.66
73_A	115_I	1.252	0.65
101_E	123_L	1.248	0.65
9_K	18_V	1.243	0.64
113_I	144_A	1.212	0.62
81_N	89_M	1.21	0.61
106_T	164_T	1.206	0.61
142_L	167_V	1.199	0.60
34_D	151_G	1.185	0.59
74_K	80_T	1.165	0.57
33_V	37_L	1.163	0.57
49_I	59_M	1.162	0.57
41_V	96_S	1.145	0.55
124_F	163_L	1.133	0.54
9_K	16_L	1.131	0.54
6_M	19_C	1.129	0.53
8_Q	16_L	1.127	0.53
7_S	18_V	1.127	0.53
64_V	104_L	1.115	0.52
42_D	46_P	1.114	0.52
73_A	142_L	1.112	0.52
21_V	24_L	1.111	0.52
8_Q	17_L	1.107	0.51
110_G	147_V	1.105	0.51
68_N	76_T	1.104	0.51
134_F	139_Q	1.104	0.51
46_P	91_L	1.098	0.50
103_V	114_R	1.096	0.50
44_P	73_A	1.096	0.50
7_S	16_L	1.092	0.50
63_N	98_I	1.089	0.49
7_S	17_L	1.089	0.49
9_K	19_C	1.077	0.48
92_K	124_F	1.076	0.48
35_L	119_A	1.071	0.48
34_D	134_F	1.071	0.48
49_I	57_G	1.068	0.47
72_D	143_K	1.067	0.47
106_T	113_I	1.064	0.47
54_V	106_T	1.058	0.46
83_L	87_L	1.057	0.46
41_V	98_I	1.055	0.46
29_G	32_P	1.055	0.46
110_G	151_G	1.054	0.46
22_C	27_M	1.053	0.46
134_F	166_V	1.041	0.45
19_C	24_L	1.041	0.45
101_E	168_D	1.022	0.43
54_V	121_N	1.021	0.43
112_G	153_Q	1.021	0.43
115_I	143_K	1.021	0.43
99_N	102_T	1.018	0.42
96_S	103_V	1.016	0.42
43_A	119_A	1.013	0.42
8_Q	18_V	1.007	0.41
75_Y	141_Q	1.003	0.41
64_V	167_V	1.001	0.41

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1n12A	2	0.7	100	0.444	Contact Map	0.251
2w07B	1	0.7882	99.8	0.634	Contact Map	0.239
2xg5B	1	0.8941	99.7	0.678	Contact Map	0.244
2uy6B	2	0.8294	99.7	0.688	Contact Map	0.26
2jtyA	1	0.8059	99.7	0.689	Contact Map	0.265
2jmrA	1	0.7824	99.6	0.699	Contact Map	0.204
1pdkB	1	0.7882	99.6	0.705	Contact Map	0.252
3bwuF	1	0.7059	99.5	0.735	Contact Map	0.463
4dwhB	2	0.7118	99.4	0.737	Contact Map	0.377
3jwnH	2	0.9059	99.4	0.739	Contact Map	0.284

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0435 seconds.