OPENSEQ.org - BEEE - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

BEEE - Putative protein BeeE from lambdoid prophage e14 region

UniProt:	P75980	Sequence MFFSGLFQRKSDAPVTTPAELADAIGLSYDTYTGKQISSQRAMRLTAVFSCVRVLAESVGMLPCNLYHLNGSLKQRATGERLHKLISTHPNGYMTPQEFWELVVTCLCLRGNFYAYKVKAFGEVAELLPVDPGCVVYALGRCQRWPEGDRRECYSAR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14253
Length:	157 (146)
Sequences:	167
Seq/Len:	1.14

BEEE
Paralog alert: 0.09 [within 20: 0.01] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
55_L	108_C	2.726	1.00
107_L	113_F	2.111	0.98
58_S	61_M	2.013	0.97
68_H	75_Q	1.963	0.96
118_V	126_E	1.962	0.96
99_F	115_A	1.866	0.94
60_G	97_Q	1.854	0.94
100_W	106_C	1.84	0.94
82_L	124_V	1.801	0.93
33_T	37_I	1.76	0.92
68_H	79_G	1.625	0.87
58_S	62_L	1.478	0.79
80_E	113_F	1.468	0.78
87_S	100_W	1.458	0.77
60_G	101_E	1.435	0.76
93_Y	100_W	1.431	0.76
96_P	100_W	1.427	0.75
50_S	60_G	1.404	0.74
105_T	109_L	1.378	0.72
51_C	90_P	1.364	0.70
94_M	130_V	1.342	0.69
106_C	132_P	1.284	0.64
90_P	112_N	1.269	0.62
119_K	124_V	1.258	0.61
117_K	124_V	1.252	0.61
90_P	95_T	1.25	0.61
60_G	74_K	1.248	0.60
100_W	104_V	1.246	0.60
87_S	96_P	1.242	0.60
93_Y	128_L	1.223	0.58
129_P	137_Y	1.22	0.58
4_S	9_R	1.22	0.58
46_T	51_C	1.206	0.56
55_L	104_V	1.202	0.56
83_H	87_S	1.196	0.56
127_L	132_P	1.196	0.56
67_Y	83_H	1.185	0.54
86_I	129_P	1.183	0.54
93_Y	139_L	1.18	0.54
21_L	31_T	1.175	0.54
117_K	127_L	1.169	0.53
103_V	115_A	1.166	0.53
53_R	57_E	1.164	0.52
94_M	99_F	1.163	0.52
106_C	129_P	1.152	0.51
52_V	109_L	1.143	0.50
3_F	13_A	1.141	0.50
38_S	72_S	1.136	0.50
60_G	108_C	1.133	0.50
31_T	46_T	1.132	0.49
2_F	5_G	1.131	0.49
105_T	130_V	1.13	0.49
99_F	112_N	1.127	0.49
112_N	132_P	1.115	0.48
3_F	6_L	1.104	0.47
55_L	107_L	1.096	0.46
47_A	64_C	1.093	0.46
49_F	54_V	1.088	0.45
60_G	115_A	1.086	0.45
99_F	127_L	1.075	0.44
97_Q	101_E	1.07	0.43
8_Q	12_D	1.063	0.43
69_L	73_L	1.052	0.42
94_M	112_N	1.05	0.42
56_A	91_N	1.039	0.41
55_L	93_Y	1.039	0.41
90_P	99_F	1.037	0.40
37_I	41_R	1.036	0.40
3_F	7_F	1.034	0.40
110_R	114_Y	1.032	0.40
1_M	7_F	1.026	0.39
71_G	144_R	1.026	0.39
26_G	35_K	1.022	0.39
15_V	18_P	1.02	0.39
106_C	113_F	1.016	0.38
82_L	100_W	1.003	0.37

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3kdrA	3	0.7325	99.9	0.533	Contact Map	0.458
3aoeE	4	0.4268	2.2	0.965	Contact Map	0.25
1hr0W	1	0.3567	2.1	0.965	Contact Map	0.075
3pegA	1	0.4076	1.9	0.966	Contact Map	0.286
2d73A	2	0.3503	1.8	0.966	Contact Map	0.003
3jywS	1	0.2102	1.8	0.966	Contact Map	0
1jlxA	2	0.3503	1.6	0.967	Contact Map	0.201
3lqcA	1	0.6115	1.5	0.968	Contact Map	0.078
2a1kA	2	0.4013	1.3	0.969	Contact Map	0
2kfpA	1	0.4076	1.3	0.969	Contact Map	0.233

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0118 seconds.