OPENSEQ.org - FIXX - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

FIXX - Ferredoxin-like protein FixX

UniProt:	P68646	Sequence MTSPVNVDVKLGVNKFNVDEEHPHIVVKADADKQALELLVKACPAGLYKKQDDGSVRFDYAGCLECGTCRILGLGSALEQWEYPRGTFGVEFRYG	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11565
Length:	95 (91)
Sequences:	212
Seq/Len:	2.33

FIXX
Paralog alert: 0.74 [within 20: 0.00] - ratio of genomes with paralogs
Cluster includes: FIXX YDIT YGCO

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
32_D	39_L	2.034	0.99
19_D	85_R	1.961	0.99
35_A	71_I	1.727	0.97
26_V	80_Q	1.666	0.97
39_L	72_L	1.602	0.96
62_G	70_R	1.597	0.96
12_G	15_K	1.485	0.93
54_G	70_R	1.479	0.92
47_L	59_D	1.463	0.92
49_K	82_E	1.396	0.89
16_F	86_G	1.374	0.88
87_T	91_E	1.372	0.88
30_D	52_D	1.365	0.88
39_L	73_G	1.361	0.88
57_R	64_L	1.347	0.87
40_V	88_F	1.28	0.83
11_L	26_V	1.263	0.82
46_G	49_K	1.261	0.82
19_D	48_Y	1.248	0.81
69_C	81_W	1.243	0.80
23_P	83_Y	1.224	0.79
10_K	62_G	1.217	0.78
24_H	27_V	1.213	0.78
32_D	73_G	1.212	0.78
10_K	86_G	1.202	0.77
85_R	88_F	1.183	0.76
34_Q	94_Y	1.173	0.75
9_V	27_V	1.146	0.72
36_L	39_L	1.137	0.71
6_N	49_K	1.134	0.71
68_T	81_W	1.134	0.71
5_V	15_K	1.133	0.71
20_E	52_D	1.128	0.71
6_N	68_T	1.128	0.71
81_W	89_G	1.112	0.69
42_A	72_L	1.111	0.69
14_N	64_L	1.104	0.68
49_K	68_T	1.097	0.67
42_A	46_G	1.075	0.65
13_V	92_F	1.075	0.65
45_A	61_A	1.062	0.64
25_I	71_I	1.059	0.63
74_L	79_E	1.057	0.63
47_L	58_F	1.036	0.61
73_G	87_T	1.03	0.60
35_A	38_L	1.028	0.60
38_L	74_L	1.021	0.59
60_Y	64_L	1.019	0.59
8_D	70_R	1.014	0.58
6_N	15_K	1.009	0.58
56_V	86_G	1.004	0.57
86_G	92_F	1	0.57

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2gmhA	2	0.9895	99.5	0.614	Contact Map	0.242
1hfeL	2	0.9684	98.2	0.773	Contact Map	0.086
1q16B	1	0.9684	98.1	0.777	Contact Map	0.141
2ivfB	1	0.9579	97.9	0.79	Contact Map	0.229
3gyxB	6	0.7474	97.8	0.796	Contact Map	0.249
1jb0C	1	0.7053	97.8	0.797	Contact Map	0.185
1jnrB	2	0.7579	97.7	0.798	Contact Map	0.191
3mm5B	2	0.9579	97.7	0.798	Contact Map	0.293
1xerA	1	0.8526	97.7	0.8	Contact Map	0.225
7fd1A	1	0.7368	97.7	0.801	Contact Map	0.249

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0493 seconds.