OPENSEQ.org - YOAH - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YOAH - UPF0181 protein YoaH

UniProt:	P67338	Sequence MFAGLPSLTHEQQQKAVERIQELMAQGMSSGQAIALVAEELRANHSGERIVARFEDEDE	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14306
Length:	59 (59)
Sequences:	85
Seq/Len:	1.44

YOAH
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
43_A	46_S	1.892	0.97
51_V	56_D	1.852	0.96
15_K	41_L	1.817	0.96
22_E	26_Q	1.797	0.95
2_F	17_V	1.526	0.87
9_T	12_Q	1.465	0.83
3_A	51_V	1.421	0.81
5_L	15_K	1.386	0.79
28_M	45_H	1.297	0.72
4_G	30_S	1.293	0.71
26_Q	57_E	1.293	0.71
11_E	22_E	1.284	0.71
26_Q	43_A	1.271	0.70
22_E	36_L	1.263	0.69
3_A	7_S	1.241	0.67
50_I	53_R	1.225	0.65
5_L	35_A	1.217	0.65
25_A	32_Q	1.2	0.63
32_Q	57_E	1.197	0.63
41_L	59_E	1.152	0.58
30_S	35_A	1.151	0.58
23_L	47_G	1.122	0.55
17_V	26_Q	1.117	0.55
28_M	36_L	1.114	0.55
24_M	55_E	1.113	0.54
18_E	59_E	1.099	0.53
15_K	37_V	1.095	0.53
21_Q	24_M	1.085	0.52
19_R	38_A	1.075	0.51
4_G	54_F	1.074	0.50
36_L	44_N	1.074	0.50
37_V	45_H	1.064	0.49
4_G	31_G	1.058	0.49
12_Q	21_Q	1.044	0.47
9_T	22_E	1.038	0.47
4_G	35_A	1.007	0.44
17_V	52_A	1.001	0.43

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
3kwpA	1	0.9831	21.5	0.887	Contact Map	0
3mmhA	2	0.9322	15.9	0.894	Contact Map	0.092
3v1vA	1	1	14.2	0.896	Contact Map	0.149
1r4tA	1	0.8814	14	0.896	Contact Map	0.199
4kwdA	4	1	13.1	0.898	Contact Map	0.132
3zxwB	4	0.8475	12.5	0.899	Contact Map	0.319
1rblM	8	0.8475	11.9	0.899	Contact Map	0.291
1svdM	1	0.9322	11.9	0.899	Contact Map	0.156
4ehoA	4	1	11.8	0.9	Contact Map	0.09
4bwiA	2	0.8983	11.6	0.9	Contact Map	0.128

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.138 seconds.