OPENSEQ.org - YECN - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YECN - Inner membrane protein YecN

UniProt:	P64515	Sequence MVSALYAVLSALLLMKFSFDVVRLRMQYRVAYGDGGFSELQSAIRIHGNAVEYIPIAIVLMLFMEMNGAETWMVHICGIVLLAGRLMHYYGFHHRLFRWRRSGMSATWCALLLMVLANLWYMPWELVFSLR	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14032
Length:	131 (121)
Sequences:	486
Seq/Len:	4.02

YECN
Paralog alert: 0.06 [within 20: 0.01] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
61_M	78_G	2.477	1.00
57_A	61_M	2.211	1.00
22_V	108_W	2.206	1.00
50_A	54_I	2.18	1.00
10_S	54_I	2.147	1.00
6_Y	75_H	2.122	1.00
9_L	82_L	2.083	1.00
84_G	106_A	2.022	1.00
17_F	89_Y	1.757	0.99
14_L	50_A	1.588	0.98
7_A	62_L	1.58	0.98
9_L	79_I	1.523	0.98
84_G	103_G	1.518	0.98
84_G	87_M	1.446	0.97
7_A	58_I	1.427	0.96
96_L	99_W	1.393	0.96
13_L	76_I	1.385	0.96
11_A	60_L	1.378	0.95
3_S	65_E	1.348	0.95
13_L	86_L	1.347	0.95
16_K	90_Y	1.341	0.94
24_L	43_A	1.327	0.94
72_W	76_I	1.299	0.93
45_R	52_E	1.296	0.93
10_S	50_A	1.292	0.93
27_Q	76_I	1.282	0.93
23_R	98_R	1.26	0.92
18_S	53_Y	1.254	0.91
5_L	78_G	1.239	0.91
105_S	109_C	1.224	0.90
59_V	62_L	1.213	0.90
2_V	68_G	1.168	0.87
34_D	44_I	1.164	0.87
17_F	46_I	1.157	0.86
92_F	97_F	1.14	0.85
28_Y	37_F	1.131	0.85
44_I	47_H	1.119	0.84
77_C	113_L	1.111	0.83
61_M	84_G	1.11	0.83
109_C	112_L	1.104	0.83
34_D	41_Q	1.1	0.82
3_S	74_V	1.094	0.82
81_L	114_M	1.09	0.82
7_A	59_V	1.087	0.81
53_Y	111_L	1.079	0.81
65_E	73_M	1.074	0.80
76_I	80_V	1.065	0.80
9_L	18_S	1.053	0.78
14_L	51_V	1.045	0.78
56_I	107_T	1.042	0.77
30_V	93_H	1.041	0.77
114_M	118_N	1.035	0.77
87_M	105_S	1.024	0.76
27_Q	70_E	1.022	0.76
80_V	109_C	1.019	0.75
116_L	119_L	1.018	0.75
81_L	85_R	1.009	0.74
34_D	48_G	1.004	0.74

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2q7rA	6	0.9847	99.9	0.297	Contact Map	0.498
3pcvA	1	0.9847	99.9	0.339	Contact Map	0.569
4al0A	1	0.9618	99.9	0.385	Contact Map	0.495
2h8aA	1	0.9542	99.9	0.392	Contact Map	0.169
2y9yB	1	0.3969	4	0.942	Contact Map	0
2l6wA	2	0.2366	3.2	0.944	Contact Map	0
2l9uA	2	0.2519	2.7	0.947	Contact Map	0
2xfcB	4	0.3664	1.9	0.951	Contact Map
2yewC	4	0.3664	1.9	0.951	Contact Map	0.527
3j0fI	4	0.3664	1.9	0.951	Contact Map	0

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0435 seconds.