OPENSEQ.org - YOAF - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YOAF - Uncharacterized protein YoaF

UniProt:	P64493	Sequence MKIISFVLPCLLVLAGCSTPSQPEAPKPPQIGMANPASVYCQQKGGTLIPVQTAQGVSNNCKLPGGETIDEWALWRRDHPAGEK	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14304
Length:	84 (83)
Sequences:	140
Seq/Len:	1.69

YOAF
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
52_Q	57_V	2.77	1.00
74_L	78_D	2.157	0.99
62_K	68_T	2.071	0.99
50_P	59_N	1.759	0.96
53_T	60_N	1.752	0.96
43_Q	75_W	1.611	0.92
38_S	71_E	1.571	0.91
74_L	77_R	1.569	0.91
18_S	51_V	1.533	0.90
9_P	75_W	1.514	0.89
4_I	7_V	1.466	0.87
64_P	74_L	1.438	0.85
33_M	66_G	1.411	0.84
48_L	70_D	1.366	0.81
58_S	70_D	1.354	0.80
44_K	78_D	1.348	0.80
67_E	77_R	1.236	0.71
57_V	74_L	1.234	0.71
56_G	66_G	1.211	0.69
16_G	47_T	1.205	0.68
69_I	77_R	1.204	0.68
16_G	40_Y	1.192	0.67
38_S	50_P	1.162	0.64
44_K	74_L	1.158	0.64
29_P	68_T	1.124	0.60
62_K	79_H	1.122	0.60
14_L	73_A	1.113	0.59
34_A	76_R	1.109	0.59
56_G	71_E	1.1	0.58
42_Q	75_W	1.099	0.58
35_N	70_D	1.095	0.57
40_Y	78_D	1.094	0.57
6_F	9_P	1.091	0.57
29_P	32_G	1.086	0.57
4_I	13_V	1.078	0.56
21_S	27_K	1.075	0.55
6_F	27_K	1.055	0.53
31_I	34_A	1.034	0.51
40_Y	69_I	1.028	0.50
35_N	72_W	1.02	0.50
40_Y	44_K	1.02	0.50
48_L	59_N	1.014	0.49
51_V	67_E	1.008	0.48
32_G	43_Q	1.005	0.48

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
3zbiC	14	0.5238	79.3	0.863	Contact Map	0
4k3vA	2	1	41.8	0.893	Contact Map	0.005
4kysA	2	0.7262	24.9	0.905	Contact Map	0.203
3k6vA	1	0.75	17.4	0.911	Contact Map	0.476
4jg9A	2	0.9643	17	0.912	Contact Map	0.088
3oa8B	3	0.8214	17	0.912	Contact Map	0.013
4jwoA	1	0.9048	14.7	0.915	Contact Map	0.001
4ivkA	1	0.9524	14	0.915	Contact Map	0.041
1yr2A	1	0.8571	12	0.918	Contact Map	0.128
2ismA	2	0.9167	11.2	0.919	Contact Map	0.16

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0441 seconds.