OPENSEQ.org - GSPI - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

GSPI - Putative type II secretion system protein I

UniProt:	P45760	Sequence MNKQSGMTLLEVLLAMSIFTAVALTLMSSMQGQRNAIERMRNETLALWIADNQLQSQDSFGEENTSSSGKELINGEEWNWRSDIHSSKDGTLLERTITVTLPSGQTTSLTRYQSIDNKSGQAQDD	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12892
Length:	125 (119)
Sequences:	308
Seq/Len:	2.59

GSPI
Paralog alert: 0.18 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
69_G	80_W	4.342	1.00
19_F	23_A	2.706	1.00
49_I	80_W	2.074	1.00
22_V	25_T	1.901	0.99
18_I	21_A	1.839	0.99
71_E	80_W	1.767	0.98
8_T	12_V	1.734	0.98
49_I	69_G	1.681	0.98
61_G	93_L	1.601	0.96
45_L	74_N	1.585	0.96
46_A	112_Y	1.492	0.94
87_S	92_L	1.488	0.94
53_Q	56_S	1.427	0.92
49_I	73_I	1.405	0.91
70_K	77_E	1.398	0.91
49_I	78_W	1.381	0.90
69_G	73_I	1.356	0.89
49_I	71_E	1.347	0.89
18_I	57_Q	1.306	0.87
28_S	55_Q	1.297	0.86
24_L	83_D	1.28	0.85
19_F	78_W	1.278	0.85
13_L	28_S	1.274	0.85
10_L	69_G	1.273	0.85
22_V	92_L	1.266	0.84
6_G	9_L	1.265	0.84
71_E	78_W	1.265	0.84
57_Q	95_R	1.264	0.84
24_L	35_N	1.252	0.83
19_F	41_R	1.25	0.83
43_E	110_T	1.217	0.81
73_I	78_W	1.193	0.79
53_Q	97_I	1.191	0.79
56_S	96_T	1.175	0.78
28_S	32_G	1.167	0.77
49_I	72_L	1.161	0.77
8_T	25_T	1.16	0.76
24_L	27_M	1.159	0.76
83_D	98_T	1.152	0.76
40_M	49_I	1.122	0.73
8_T	11_E	1.099	0.71
35_N	45_L	1.095	0.70
108_S	111_R	1.088	0.70
81_R	98_T	1.085	0.69
97_I	100_T	1.085	0.69
51_D	112_Y	1.08	0.69
73_I	80_W	1.059	0.67
14_L	32_G	1.057	0.66
46_A	53_Q	1.045	0.65
17_S	22_V	1.039	0.65
110_T	114_S	1.034	0.64
96_T	113_Q	1.033	0.64
61_G	88_K	1.025	0.63
105_Q	108_S	1.024	0.63
12_V	32_G	1.018	0.62
82_S	96_T	1.012	0.62
31_Q	49_I	1.006	0.61
42_N	76_E	1.005	0.61
33_Q	37_I	1.004	0.61

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2retA	4	0.736	99.9	0.453	Contact Map	0.585
3ci0I	1	0.688	99.9	0.453	Contact Map	0.594
2m7gA	1	0.464	95.6	0.837	Contact Map	0.274
2hi2A	1	0.888	94.6	0.847	Contact Map	0.281
3sokA	2	0.92	94.3	0.85	Contact Map	0.203
1oqwA	2	0.928	90.1	0.868	Contact Map	0.32
2yevB	2	0.928	5.7	0.941	Contact Map	0.205
4bw5A	4	0.4	3.6	0.946	Contact Map	0.693
4kkrA	2	0.328	3.2	0.947	Contact Map	0
3lczA	4	0.152	1.8	0.954	Contact Map	0.518

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0105 seconds.