OPENSEQ.org - YHDT - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YHDT - Uncharacterized protein YhdT

UniProt:	P45566	Sequence MDTRFVQAHKEARWALGLTLLYLAVWLVAAYLSGVAPGFTGFPRWFEMACILTPLLFIGLCWAMVKFIYRDIPLEDDDAA	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12831
Length:	80 (79)
Sequences:	143
Seq/Len:	1.81

YHDT
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
25_V	53_T	2.478	1.00
4_R	8_A	1.753	0.96
42_F	51_I	1.676	0.95
24_A	55_L	1.659	0.94
27_L	53_T	1.562	0.92
38_G	47_E	1.555	0.92
20_L	24_A	1.51	0.90
34_G	44_R	1.507	0.90
16_L	21_L	1.452	0.87
44_R	52_L	1.418	0.86
66_K	70_R	1.41	0.85
23_L	27_L	1.401	0.85
71_D	74_L	1.388	0.84
57_F	64_M	1.369	0.83
21_L	56_L	1.34	0.81
56_L	67_F	1.305	0.79
20_L	55_L	1.304	0.79
15_A	22_Y	1.299	0.78
61_C	64_M	1.298	0.78
75_E	78_D	1.297	0.78
16_L	63_A	1.288	0.77
29_A	56_L	1.25	0.74
22_Y	50_C	1.245	0.74
66_K	69_Y	1.238	0.73
2_D	41_G	1.202	0.70
14_W	68_I	1.198	0.70
6_V	10_K	1.117	0.62
6_V	21_L	1.116	0.62
44_R	48_M	1.108	0.61
10_K	51_I	1.091	0.59
49_A	52_L	1.09	0.59
15_A	69_Y	1.082	0.58
1_M	5_F	1.075	0.57
27_L	52_L	1.053	0.55
18_L	57_F	1.046	0.54
15_A	31_Y	1.041	0.54
54_P	57_F	1.03	0.53
9_H	60_L	1.027	0.52
1_M	76_D	1.018	0.51
37_P	59_G	1.015	0.51
7_Q	28_V	1.008	0.50
21_L	28_V	1.006	0.50
48_M	52_L	1.002	0.50
7_Q	15_A	1.002	0.50

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
4k5yA	3	0.975	8.7	0.925	Contact Map	0.056
2zy9A	2	0.875	5.2	0.932	Contact Map	0.167
2l8sA	1	0.5625	4.3	0.935	Contact Map	0.22
2kncA	1	0.6	4.1	0.936	Contact Map	0.343
3dinE	2	0.425	2.7	0.941	Contact Map	0.001
2kogA	1	0.3875	2.3	0.943	Contact Map	0.211
4djkA	2	0.9875	2.1	0.945	Contact Map	0.14
2daqA	1	0.3375	2.1	0.945	Contact Map	0.025
2cfqA	1	0.975	1.9	0.946	Contact Map	0.181
3b1vA	1	0.3375	1.9	0.946	Contact Map	0.815

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.009 seconds.