OPENSEQ.org - PTPB2 - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

PTPB2 - N-acetylgalactosamine-specific phosphotransferase enzyme IIB component 2

UniProt:	P42904	Sequence MPNIVLSRIDERLIHGQVGVQWVGFAGANLVLVANDEVAEDPVQQNLMEMVLAEGIAVRFWTLQKVIDNIHRAADRQKILLVCKTPADFLTLVKGGVPVNRINVGNMHYANGKQQIAKTVSVDAGDIAAFNDLKTAGVECFVQGVPTEPAVDLFKLL	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12764
Length:	157 (156)
Sequences:	900
Seq/Len:	5.77

PTPB2
Paralog alert: 0.84 [within 20: 0.20] - ratio of genomes with paralogs
Cluster includes: PTPB1 PTPB2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
35_N	88_D	4.697	1.00
94_K	132_D	3.729	1.00
67_I	95_G	3.34	1.00
89_F	102_I	2.845	1.00
124_A	128_A	2.515	1.00
83_C	89_F	2.336	1.00
139_E	150_A	2.316	1.00
63_L	91_T	2.235	1.00
101_R	139_E	2.231	1.00
93_V	133_L	2.205	1.00
94_K	136_A	2.079	1.00
90_L	132_D	2.066	1.00
64_Q	68_D	1.975	1.00
44_Q	84_K	1.892	1.00
23_V	56_I	1.888	1.00
36_D	91_T	1.86	1.00
116_I	122_V	1.823	1.00
90_L	94_K	1.802	1.00
27_G	78_K	1.781	1.00
128_A	132_D	1.75	1.00
28_A	80_L	1.694	1.00
52_L	58_V	1.684	1.00
90_L	129_A	1.618	0.99
114_Q	124_A	1.607	0.99
83_C	92_L	1.571	0.99
114_Q	127_I	1.555	0.99
35_N	84_K	1.546	0.99
64_Q	91_T	1.512	0.99
39_A	62_T	1.507	0.99
9_I	130_F	1.505	0.99
87_A	129_A	1.484	0.99
152_D	155_K	1.468	0.99
5_V	26_A	1.457	0.99
91_T	94_K	1.442	0.98
87_A	125_G	1.436	0.98
104_V	130_F	1.422	0.98
131_N	135_T	1.395	0.98
132_D	136_A	1.39	0.98
93_V	99_V	1.378	0.98
86_P	107_M	1.368	0.98
9_I	86_P	1.364	0.98
9_I	104_V	1.349	0.97
7_S	89_F	1.335	0.97
132_D	135_T	1.311	0.97
106_N	119_T	1.302	0.97
65_K	68_D	1.284	0.96
30_L	59_R	1.258	0.96
113_K	123_D	1.257	0.96
101_R	141_F	1.225	0.95
38_V	103_N	1.22	0.95
125_G	128_A	1.217	0.94
11_E	106_N	1.198	0.94
143_Q	146_P	1.195	0.94
7_S	81_L	1.183	0.93
34_A	66_V	1.176	0.93
110_A	113_K	1.172	0.93
134_K	154_F	1.168	0.93
63_L	88_D	1.166	0.93
42_P	45_Q	1.163	0.93
5_V	78_K	1.16	0.92
101_R	150_A	1.142	0.92
86_P	130_F	1.132	0.91
86_P	129_A	1.128	0.91
91_T	95_G	1.097	0.89
38_V	44_Q	1.096	0.89
7_S	99_V	1.095	0.89
125_G	129_A	1.09	0.89
11_E	108_H	1.088	0.89
104_V	142_V	1.087	0.89
62_T	65_K	1.084	0.89
30_L	77_Q	1.078	0.88
31_V	82_V	1.075	0.88
5_V	28_A	1.073	0.88
41_D	44_Q	1.067	0.88
21_Q	146_P	1.021	0.84
93_V	102_I	1.02	0.84
82_V	121_S	1.018	0.84
107_M	122_V	1.009	0.83
69_N	72_R	1.008	0.83
11_E	14_I	1.006	0.83
90_L	136_A	1.006	0.83

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1bleA	1	1	100	-0.002	Contact Map	0.724
3lfjA	2	1	100	-0.001	Contact Map	0.67
1vsqC	1	1	100	0.008	Contact Map	0.608
1nrzA	4	0.9936	100	0.012	Contact Map	0.79
3eyeA	1	1	100	0.037	Contact Map	0.741
3p3vA	2	0.9936	100	0.048	Contact Map	0.727
2ps1A	2	0.7261	24.1	0.939	Contact Map	0.277
2wk1A	1	0.4713	16.9	0.943	Contact Map	0.199
2jnbA	1	0.6369	14.8	0.945	Contact Map	0.116
1w41A	1	0.5796	13.6	0.946	Contact Map	0.353

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0538 seconds.