OPENSEQ.org - YQJC - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YQJC - Protein YqjC

UniProt:	P42616	Sequence MKYRIALAVSLFALSAGSYATTLCQEKEQNILKEISYAEKHQNQNRIDGLNKALSEVRANCSDSQLRADHQKKIAKQKDEVAERQQDLAEAKQKGDADKIAKRERKLAEAQEELKKLEARDY	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12742
Length:	122 (122)
Sequences:	159
Seq/Len:	1.30

YQJC
Paralog alert: 0.02 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
31_I	57_V	2.42	0.99
71_Q	75_A	2.126	0.98
81_V	107_L	1.925	0.96
39_E	51_N	1.68	0.91
81_V	117_L	1.634	0.89
35_I	56_E	1.608	0.88
84_R	100_I	1.519	0.84
85_Q	111_Q	1.517	0.84
26_E	117_L	1.507	0.84
80_E	103_R	1.482	0.82
94_K	103_R	1.476	0.82
12_F	18_S	1.474	0.82
81_V	113_E	1.458	0.81
87_D	103_R	1.402	0.77
101_A	119_A	1.392	0.76
70_H	117_L	1.384	0.76
92_K	104_E	1.377	0.75
35_I	47_I	1.362	0.74
28_E	58_R	1.359	0.74
6_A	17_G	1.341	0.72
84_R	110_A	1.305	0.69
81_V	110_A	1.305	0.69
25_Q	70_H	1.299	0.69
6_A	97_A	1.297	0.69
62_S	65_Q	1.281	0.67
56_E	60_N	1.247	0.64
5_I	15_S	1.246	0.64
14_L	40_K	1.243	0.64
49_G	109_E	1.227	0.62
8_A	13_A	1.227	0.62
52_K	56_E	1.226	0.62
84_R	103_R	1.215	0.61
74_I	93_Q	1.207	0.61
41_H	83_E	1.195	0.59
57_V	102_K	1.189	0.59
10_S	13_A	1.177	0.58
23_L	26_E	1.17	0.57
26_E	121_D	1.167	0.57
3_Y	12_F	1.159	0.56
90_E	115_K	1.132	0.53
29_Q	41_H	1.131	0.53
80_E	87_D	1.128	0.53
32_L	36_S	1.12	0.52
77_Q	103_R	1.102	0.50
30_N	90_E	1.094	0.50
80_E	108_A	1.093	0.49
89_A	92_K	1.091	0.49
48_D	62_S	1.085	0.49
26_E	63_D	1.082	0.48
22_T	26_E	1.081	0.48
76_K	79_D	1.073	0.47
67_R	116_K	1.065	0.47
40_K	119_A	1.061	0.46
58_R	86_Q	1.046	0.45
116_K	121_D	1.037	0.44
115_K	119_A	1.037	0.44
10_S	18_S	1.036	0.44
98_D	102_K	1.029	0.43
77_Q	87_D	1.025	0.43
27_K	108_A	1.024	0.43
85_Q	115_K	1.019	0.42
66_L	84_R	1.015	0.42
33_K	74_I	1.008	0.41
59_A	111_Q	1.007	0.41
60_N	64_S	1.005	0.41
102_K	109_E	1.002	0.40

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
4b6xA	2	0.6475	87.5	0.873	Contact Map	0.435
3layA	10	0.8115	71.1	0.893	Contact Map	0.331
3ioxA	1	0.7951	53.4	0.904	Contact Map	0.052
3vkgA	2	0.9262	37.3	0.913	Contact Map	0.106
2pmsC	2	0.8934	27.9	0.918	Contact Map	0.244
4fzsA	2	1	23.7	0.921	Contact Map	0.216
1w9rA	1	0.6639	19.1	0.924	Contact Map	0.036
2lf0A	1	0.4918	19	0.924	Contact Map	0.261
1gp8A	1	0.3279	15.3	0.928	Contact Map	0.128
1fzcB	2	0.4426	15.3	0.928	Contact Map	0.155

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.