OPENSEQ.org - HIPB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

HIPB - Antitoxin HipB

UniProt:	P23873	Sequence MMSFQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLCDAKNASPESTEQQNLEW	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10442
Length:	88 (85)
Sequences:	126
Seq/Len:	1.48

HIPB
Paralog alert: 0.02 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
41_T	56_T	2.276	0.99
38_K	41_T	2.006	0.98
23_Q	70_L	1.937	0.97
39_Q	43_S	1.617	0.91
14_A	38_K	1.574	0.89
62_Q	67_S	1.506	0.86
10_P	64_L	1.468	0.84
45_F	56_T	1.405	0.80
12_Q	34_K	1.335	0.76
79_E	83_Q	1.317	0.74
44_N	53_T	1.282	0.71
52_T	65_E	1.255	0.69
42_I	66_L	1.235	0.67
70_L	78_P	1.208	0.65
7_I	73_A	1.207	0.65
20_V	57_F	1.206	0.64
14_A	20_V	1.187	0.63
10_P	18_K	1.184	0.62
14_A	45_F	1.175	0.61
82_E	87_E	1.164	0.60
62_Q	73_A	1.141	0.58
41_T	58_F	1.136	0.58
18_K	59_K	1.133	0.57
37_I	53_T	1.112	0.55
39_Q	56_T	1.105	0.54
84_Q	87_E	1.101	0.54
66_L	73_A	1.1	0.54
18_K	67_S	1.093	0.53
83_Q	87_E	1.06	0.50
37_I	57_F	1.056	0.49
18_K	69_T	1.042	0.48
25_G	81_T	1.04	0.48
62_Q	65_E	1.039	0.48
45_F	49_P	1.033	0.47
18_K	64_L	1.028	0.47
54_L	69_T	1.022	0.46
8_Y	31_L	1.021	0.46
22_Q	53_T	1.019	0.46
28_Q	39_Q	1.012	0.45
45_F	58_F	1.01	0.45
38_K	56_T	1.008	0.45
17_M	60_I	1.004	0.44
31_L	40_A	1.001	0.44

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2wiuB	2	1	99.3	0.535	Contact Map	0.213
3g7dA	1	0.9773	99.1	0.589	Contact Map	0.176
4ichA	2	0.9886	98.9	0.612	Contact Map	0
3ivpA	4	1	98.9	0.615	Contact Map	0.218
3vk0A	3	0.9886	98.9	0.616	Contact Map	0.193
1y9qA	1	0.9659	98.9	0.618	Contact Map	0.177
3g5gA	14	0.9091	98.9	0.622	Contact Map	0.197
1dw9A	10	1	98.9	0.622	Contact Map	0.156
2o38A	2	1	98.9	0.623	Contact Map	0.227
3f6wA	5	0.9205	98.8	0.628	Contact Map	0.281

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0094 seconds.