OPENSEQ.org - PSPC - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

PSPC - Phage shock protein C

UniProt:	P0AFN2	Sequence MAGINLNKKLWRIPQQGMVRGVCAGIANYFDVPVKLVRILVVLSIFFGLALFTLVAYIILSFALDPMPDNMAFGEQLPSSSELLDEVDRELAASETRLREMERYVTSDTFTLRSRFRQL	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10778
Length:	119 (115)
Sequences:	223
Seq/Len:	1.94

PSPC
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
20_R	61_S	2.695	1.00
13_I	16_Q	2.305	1.00
30_F	98_L	1.767	0.97
37_V	46_F	1.714	0.96
59_I	63_A	1.702	0.96
10_L	64_L	1.61	0.94
34_V	58_I	1.545	0.92
48_G	60_L	1.465	0.89
23_C	27_A	1.456	0.89
23_C	41_V	1.452	0.89
35_K	43_L	1.423	0.87
63_A	86_E	1.417	0.87
20_R	96_T	1.393	0.86
58_I	61_S	1.36	0.84
44_S	53_T	1.285	0.79
26_I	77_L	1.279	0.78
86_E	92_A	1.265	0.77
11_W	68_P	1.263	0.77
51_L	116_F	1.259	0.77
40_L	71_M	1.246	0.76
41_V	45_I	1.245	0.76
26_I	112_L	1.241	0.75
33_P	115_R	1.228	0.74
19_V	100_E	1.227	0.74
115_R	118_Q	1.222	0.74
60_L	109_T	1.202	0.72
32_V	63_A	1.196	0.72
69_D	101_M	1.188	0.71
80_S	101_M	1.176	0.70
97_R	119_L	1.169	0.69
17_G	24_A	1.164	0.69
59_I	66_P	1.163	0.69
42_V	50_A	1.159	0.68
8_K	28_N	1.158	0.68
79_S	86_E	1.157	0.68
52_F	65_D	1.156	0.68
26_I	64_L	1.15	0.67
113_R	118_Q	1.149	0.67
10_L	60_L	1.147	0.67
109_T	116_F	1.147	0.67
66_P	115_R	1.144	0.67
45_I	59_I	1.14	0.66
98_L	119_L	1.134	0.66
54_L	105_V	1.128	0.65
64_L	110_F	1.108	0.63
42_V	54_L	1.101	0.62
54_L	74_G	1.081	0.60
62_F	118_Q	1.079	0.60
26_I	92_A	1.074	0.59
109_T	112_L	1.069	0.59
40_L	50_A	1.063	0.58
105_V	110_F	1.058	0.58
63_A	79_S	1.055	0.57
69_D	73_F	1.049	0.57
59_I	118_Q	1.026	0.54
15_Q	65_D	1.022	0.54
39_I	44_S	1.021	0.54
43_L	55_V	1.021	0.54
62_F	109_T	1.02	0.54
83_L	87_V	1.013	0.53
36_L	47_F	1.013	0.53
33_P	43_L	1.012	0.53
28_N	67_M	1.009	0.52

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
4i5sA	2	0.7899	52.3	0.917	Contact Map	0.117
4binA	1	0.3277	30.7	0.928	Contact Map	0.352
4hwdD	3	0.3697	27.1	0.929	Contact Map	0.307
4hwcA	6	0.3697	26.6	0.93	Contact Map	0.312
3ne8A	1	0.3277	25	0.93	Contact Map	0.003
2f95B	1	0.9748	21.4	0.933	Contact Map	0.221
4hwhA	5	0.3529	14.2	0.938	Contact Map	0.298
3swfA	3	0.3697	11.2	0.941	Contact Map	0.249
3ci9A	2	0.3109	10.7	0.941	Contact Map	0
4etpB	1	0.3361	10.6	0.941	Contact Map	0.226

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.035 seconds.