OPENSEQ.org - YJFL - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YJFL - UPF0719 inner membrane protein YjfL

UniProt:	P0AF80	Sequence MHILDSLLAFSAYFFIGVAMVIIFLFIYSKITPHNEWQLIKNNNTAASLAFSGTLLGYVIPLSSAAINAVSIPDYFAWGGIALVIQLLVFAGVRLYMPALSEKIINHNTAAGMFMGTAALAGGIFNAACMTW	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12487
Length:	132 (132)
Sequences:	219
Seq/Len:	1.66

YJFL
Paralog alert: 0.04 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
103_K	108_N	2.758	1.00
47_A	104_I	2.123	0.99
52_S	117_T	2.004	0.98
69_A	74_D	1.943	0.98
28_Y	54_T	1.698	0.94
41_K	100_L	1.616	0.92
56_L	63_S	1.609	0.92
76_F	80_G	1.586	0.91
10_F	130_M	1.565	0.91
49_L	116_G	1.546	0.90
13_Y	66_A	1.476	0.87
64_S	68_N	1.461	0.86
100_L	129_C	1.412	0.84
38_Q	42_N	1.401	0.83
8_L	27_I	1.39	0.82
20_M	79_G	1.388	0.82
34_H	101_S	1.368	0.81
24_F	58_Y	1.361	0.80
60_I	63_S	1.305	0.76
49_L	112_G	1.28	0.74
35_N	38_Q	1.263	0.73
53_G	112_G	1.257	0.72
37_W	51_F	1.246	0.72
54_T	126_N	1.222	0.69
120_L	124_I	1.215	0.69
37_W	41_K	1.215	0.69
113_M	116_G	1.213	0.69
116_G	120_L	1.208	0.68
65_A	130_M	1.207	0.68
18_V	120_L	1.187	0.66
24_F	54_T	1.137	0.61
58_Y	66_A	1.132	0.61
90_F	111_A	1.126	0.60
28_Y	61_P	1.123	0.60
8_L	18_V	1.116	0.59
116_G	126_N	1.115	0.59
56_L	117_T	1.108	0.58
12_A	72_I	1.107	0.58
90_F	110_A	1.106	0.58
39_L	47_A	1.102	0.58
18_V	84_V	1.102	0.58
17_G	66_A	1.091	0.57
28_Y	126_N	1.089	0.56
42_N	124_I	1.086	0.56
45_T	113_M	1.084	0.56
16_I	76_F	1.083	0.56
41_K	128_A	1.083	0.56
99_A	105_I	1.076	0.55
113_M	124_I	1.071	0.54
89_V	95_L	1.067	0.54
66_A	129_C	1.065	0.54
103_K	111_A	1.059	0.53
52_S	80_G	1.056	0.53
27_I	106_N	1.054	0.53
82_A	94_R	1.054	0.53
20_M	107_H	1.046	0.52
64_S	89_V	1.035	0.51
87_L	96_Y	1.035	0.51
35_N	116_G	1.032	0.50
33_P	126_N	1.032	0.50
15_F	114_F	1.03	0.50
11_S	72_I	1.03	0.50
74_D	132_W	1.029	0.50
56_L	124_I	1.026	0.50
124_I	127_A	1.022	0.49
82_A	126_N	1.02	0.49
26_F	30_K	1.014	0.48
70_V	74_D	1.007	0.48
20_M	76_F	1.007	0.48
7_L	74_D	1	0.47
73_P	80_G	1	0.47

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
4ainA	3	0.9924	8	0.945	Contact Map	0.091
1qleD	1	0.2273	5.6	0.949	Contact Map	0
1m56D	2	0.2273	4.6	0.951	Contact Map	0.245
4av3A	2	0.5303	4.5	0.951	Contact Map	0.008
2wswA	1	0.9773	3.5	0.954	Contact Map	0.119
2lx0A	1	0.2348	2.6	0.957	Contact Map	0
2m7xA	1	0.1439	2.2	0.958	Contact Map	0.278
1md8A	1	0.3333	1.6	0.961	Contact Map	0
4c7rA	3	0.9924	1.5	0.962	Contact Map	0.045
2c42A	2	0.6894	1.4	0.962	Contact Map	0.069

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.1527 seconds.