OPENSEQ.org - ZAPB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

ZAPB - Cell division protein ZapB

UniProt:	P0AF36	Sequence MTMSLEVFEKLEAKVQQAIDTITLLQMEIEELKEKNNSLSQEVQNAQHQREELERENNHLKEQQNGWQERLQALLGRMEEV	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11878
Length:	81 (79)
Sequences:	86
Seq/Len:	1.09

ZAPB
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
63_Q	72_Q	2.587	1.00
62_E	80_E	2.001	0.96
57_N	67_W	1.952	0.95
38_S	69_E	1.785	0.92
4_S	76_G	1.73	0.90
6_E	67_W	1.722	0.90
6_E	57_N	1.593	0.84
47_Q	63_Q	1.471	0.77
57_N	60_L	1.457	0.76
14_K	25_L	1.375	0.70
35_K	60_L	1.371	0.70
35_K	42_E	1.351	0.68
63_Q	71_L	1.347	0.68
9_E	20_D	1.283	0.62
7_V	78_M	1.282	0.62
15_V	29_I	1.264	0.60
18_A	81_V	1.242	0.58
45_N	59_H	1.23	0.57
22_I	25_L	1.221	0.57
55_R	61_K	1.22	0.56
68_Q	72_Q	1.208	0.55
15_V	36_N	1.203	0.55
17_Q	71_L	1.157	0.50
6_E	78_M	1.149	0.50
20_D	77_R	1.121	0.47
16_Q	39_L	1.116	0.47
21_T	26_Q	1.112	0.46
56_E	71_L	1.078	0.43
52_E	60_L	1.07	0.42
4_S	31_E	1.069	0.42
9_E	16_Q	1.065	0.42
43_V	46_A	1.064	0.42
14_K	34_E	1.06	0.41
56_E	60_L	1.058	0.41
41_Q	56_E	1.046	0.40
41_Q	58_N	1.039	0.39
9_E	15_V	1.036	0.39
20_D	23_T	1.03	0.39
47_Q	58_N	1.025	0.38
38_S	73_A	1.018	0.38
48_H	65_N	1.016	0.37
54_E	58_N	1.013	0.37
14_K	22_I	1.004	0.36
56_E	61_K	1.002	0.36
40_S	44_Q	1	0.36

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2jeeA	4	1	100	0.187	Contact Map	0.107
1i84S	2	1	81.4	0.862	Contact Map
2dfsA	2	1	69.9	0.875	Contact Map	0.171
3vkgA	2	1	66.6	0.878	Contact Map	0.098
2v66B	4	0.8395	59.9	0.883	Contact Map	0.17
1c1gA	4	1	58.8	0.884	Contact Map	0.172
3ojaB	1	1	58.2	0.884	Contact Map	0.113
2j5uA	2	0.8889	55.2	0.886	Contact Map	0.268
2v71A	2	0.963	51	0.889	Contact Map	0.13
3hnwA	2	0.9012	46.8	0.892	Contact Map	0.125

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0135 seconds.