OPENSEQ.org - EUTN - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

EUTN - Ethanolamine utilization protein EutN

UniProt:	P0AEJ8	Sequence MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14186
Length:	95 (95)
Sequences:	303
Seq/Len:	3.19

EUTN
Paralog alert: 0.35 [within 20: 0.01] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
3_L	82_V	3.516	1.00
42_V	56_L	2.143	1.00
31_D	35_N	1.913	1.00
60_G	64_R	1.905	0.99
25_L	78_V	1.688	0.98
43_A	78_V	1.669	0.98
23_K	47_I	1.627	0.98
54_W	82_V	1.598	0.98
53_E	81_I	1.571	0.97
15_R	21_H	1.479	0.96
6_V	27_V	1.473	0.96
91_V	94_H	1.444	0.95
27_V	43_A	1.428	0.95
58_V	62_S	1.404	0.94
18_G	73_P	1.389	0.93
2_K	29_M	1.375	0.93
14_V	17_H	1.366	0.93
6_V	43_A	1.364	0.93
30_I	54_W	1.356	0.92
16_H	66_A	1.351	0.92
6_V	25_L	1.351	0.92
63_A	75_D	1.334	0.91
48_G	53_E	1.33	0.91
42_V	75_D	1.316	0.91
88_G	92_I	1.287	0.89
47_I	77_C	1.27	0.89
24_L	62_S	1.248	0.87
13_T	19_L	1.227	0.86
30_I	37_D	1.218	0.86
10_I	66_A	1.206	0.85
10_I	41_A	1.199	0.84
59_S	76_L	1.193	0.84
3_L	42_V	1.192	0.84
61_S	64_R	1.175	0.83
11_V	22_D	1.171	0.83
22_D	44_I	1.147	0.81
11_V	26_M	1.142	0.80
29_M	41_A	1.128	0.79
28_E	40_C	1.123	0.79
2_K	73_P	1.12	0.78
74_V	77_C	1.118	0.78
15_R	47_I	1.112	0.78
65_Q	70_E	1.106	0.77
26_M	33_Q	1.094	0.76
4_A	18_G	1.092	0.76
7_T	20_A	1.088	0.76
91_V	95_K	1.085	0.75
30_I	34_G	1.068	0.74
27_V	57_L	1.065	0.73
2_K	41_A	1.042	0.71
63_A	79_I	1.035	0.70
60_G	63_A	1.034	0.70
47_I	81_I	1.021	0.69
67_H	70_E	1.021	0.69
58_V	66_A	1.01	0.68
2_K	36_P	1.008	0.67
75_D	81_I	1.006	0.67

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2qw7A	10	1	100	0.034	Contact Map	0.576
4jw0B	5	1	100	0.036	Contact Map	0.546
2hd3A	12	1	100	0.041	Contact Map	0.666
4jvzA	5	1	100	0.041	Contact Map	0.558
4i7aA	5	1	100	0.089	Contact Map	0.584
2rcfA	5	0.9474	100	0.152	Contact Map	0.605
1t5oA	4	0.8947	5.5	0.931	Contact Map	0.16
3rfuA	4	0.8316	4.8	0.933	Contact Map	0.035
3gmeA	1	0.9579	4.4	0.934	Contact Map	0.095
1x3lA	1	0.8947	4	0.936	Contact Map	0.239

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0391 seconds.