OPENSEQ.org - CHAB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

CHAB - Cation transport regulator ChaB

UniProt:	P0AE63	Sequence MPYKTKSDLPESVKHVLPSHAQDIYKEAFNSAWDQYKDKEDRRDDASREETAHKVAWAAVKHEYAKGDDDKWHKKS	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12402
Length:	76 (76)
Sequences:	120
Seq/Len:	1.58

CHAB
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
25_Y	53_H	2.929	1.00
67_G	73_H	2.852	1.00
40_E	44_D	2.057	0.99
43_R	46_A	2.015	0.98
6_K	26_K	1.914	0.97
6_K	23_D	1.839	0.97
62_H	74_K	1.81	0.96
69_D	73_H	1.737	0.95
12_S	15_H	1.668	0.93
40_E	43_R	1.641	0.92
27_E	35_Q	1.555	0.90
1_M	21_A	1.537	0.89
3_Y	30_N	1.49	0.87
25_Y	33_W	1.486	0.87
65_A	75_K	1.46	0.85
13_V	31_S	1.388	0.81
39_K	44_D	1.352	0.79
40_E	46_A	1.335	0.77
59_A	66_K	1.33	0.77
46_A	51_T	1.303	0.75
31_S	34_D	1.255	0.71
54_K	66_K	1.238	0.69
29_F	49_E	1.197	0.66
33_W	48_R	1.191	0.65
70_D	76_S	1.189	0.65
3_Y	32_A	1.15	0.61
64_Y	72_W	1.142	0.60
38_D	43_R	1.128	0.59
32_A	36_Y	1.12	0.58
4_K	8_D	1.102	0.56
16_V	71_K	1.094	0.55
48_R	53_H	1.087	0.55
42_R	48_R	1.071	0.53
61_K	74_K	1.064	0.52
38_D	76_S	1.06	0.52
63_E	74_K	1.056	0.51
26_K	31_S	1.04	0.50
17_L	74_K	1.036	0.49
20_H	23_D	1.016	0.47
36_Y	66_K	1.004	0.46
65_A	73_H	1.003	0.46

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1sg7A	1	1	100	0.109	Contact Map	0.433
3aa0A	1	0.9868	8.2	0.928	Contact Map	0.082
1zy7A	2	0.7895	7.2	0.929	Contact Map	0.144
3l1nA	1	0.4737	7.1	0.93	Contact Map	0.29
4djaA	1	0.5263	7	0.93	Contact Map	0.283
1fc6A	1	0.6053	5.7	0.933	Contact Map	0.184
4l8kA	4	0.6842	5.5	0.933	Contact Map	0.138
4ld6A	1	0.6579	4.9	0.935	Contact Map	0.169
1uvqC	1	0.3684	4.7	0.935	Contact Map	0
2lh0A	2	0.7763	4	0.938	Contact Map	0.087

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.008 seconds.