OPENSEQ.org - C561 - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

C561 - Cytochrome b561

UniProt:	P0ABE5	Sequence MENKYSRLQISIHWLVFLLVIAAYCAMEFRGFFPRSDRPLINMIHVSCGISILVLMVVRLLLRLKYPTPPIIPKPKPMMTGLAHLGHLVIYLLFIALPVIGLVMMYNRGNPWFAFGLTMPYASEANFERVDSLKSWHETLANLGYFVIGLHAAAALAHHYFWKDNTLLRMMPRKRS	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG10172
Length:	176 (172)
Sequences:	1270
Seq/Len:	7.38

C561
Paralog alert: 0.76 [within 20: 0.01] - ratio of genomes with paralogs
Cluster includes: C561 C56H C56I

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
157_A	162_W	4.184	1.00
102_L	106_Y	3.088	1.00
156_L	160_Y	3.065	1.00
20_V	94_F	2.802	1.00
16_V	56_M	2.681	1.00
9_Q	62_L	2.47	1.00
88_L	92_L	2.357	1.00
159_H	166_T	2.298	1.00
27_M	30_R	2.182	1.00
47_S	115_F	2.178	1.00
16_V	94_F	2.07	1.00
86_G	150_L	2.061	1.00
76_K	79_M	2.035	1.00
8_L	62_L	1.95	1.00
16_V	55_L	1.908	1.00
6_S	9_Q	1.853	1.00
159_H	167_L	1.84	1.00
81_G	84_H	1.834	1.00
6_S	62_L	1.819	1.00
56_M	94_F	1.795	1.00
6_S	66_Y	1.766	1.00
11_S	15_L	1.674	1.00
159_H	168_L	1.674	1.00
9_Q	66_Y	1.586	1.00
51_S	114_A	1.575	1.00
56_M	95_I	1.546	1.00
46_V	105_M	1.474	0.99
135_S	138_E	1.461	0.99
148_I	152_A	1.42	0.99
150_L	154_A	1.385	0.99
60_L	95_I	1.381	0.99
129_R	132_S	1.358	0.99
159_H	165_N	1.358	0.99
99_V	103_V	1.343	0.98
53_L	102_L	1.342	0.98
161_F	164_D	1.322	0.98
54_V	61_L	1.318	0.98
106_Y	122_A	1.31	0.98
166_T	169_R	1.31	0.98
85_L	88_L	1.31	0.98
28_E	33_F	1.288	0.98
37_D	41_I	1.288	0.98
103_V	133_L	1.275	0.98
83_A	86_G	1.264	0.97
144_G	148_I	1.253	0.97
77_P	81_G	1.247	0.97
86_G	154_A	1.233	0.97
28_E	32_F	1.225	0.97
126_N	129_R	1.221	0.97
34_P	38_R	1.214	0.96
62_L	66_Y	1.209	0.96
63_R	68_T	1.187	0.96
12_I	58_V	1.172	0.95
154_A	164_D	1.156	0.95
24_Y	148_I	1.151	0.95
27_M	32_F	1.149	0.95
23_A	52_I	1.132	0.94
146_F	150_L	1.131	0.94
26_A	34_P	1.129	0.94
5_Y	9_Q	1.117	0.94
91_Y	94_F	1.112	0.93
45_H	49_G	1.111	0.93
167_L	171_M	1.105	0.93
165_N	168_L	1.102	0.93
96_A	140_L	1.097	0.93
22_A	48_C	1.087	0.92
81_G	85_L	1.086	0.92
8_L	11_S	1.085	0.92
26_A	30_R	1.085	0.92
72_I	166_T	1.081	0.92
20_V	56_M	1.076	0.92
149_G	153_A	1.072	0.92
75_P	166_T	1.068	0.92
26_A	32_F	1.066	0.91
77_P	80_T	1.051	0.91
94_F	98_P	1.05	0.91
53_L	98_P	1.04	0.90
50_I	112_W	1.039	0.90
57_V	61_L	1.025	0.89
142_N	146_F	1.017	0.89
51_S	115_F	1.016	0.89
27_M	33_F	1.016	0.89
29_F	34_P	1.001	0.88

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
4gd3A	2	0.9943	100	0.444	Contact Map	0.351
1kqfC	1	0.8977	99.9	0.501	Contact Map	0.514
1q16C	1	0.9091	8.5	0.948	Contact Map	0.445
3cx5C	2	0.6818	7.5	0.949	Contact Map	0.441
1pp9C	2	0.6761	3.4	0.957	Contact Map	0.378
2mc7A	1	0.1648	2.5	0.959	Contact Map	0.322
2qjyA	6	0.7386	2.3	0.96	Contact Map	0.47
3ideA	5	0.2955	2	0.962	Contact Map	0.035
4h44A	1	0.6989	1.8	0.963	Contact Map	0.426
3arcL	2	0.2102	1.6	0.964	Contact Map	0.404

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0268 seconds.