OPENSEQ.org - YAII - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YAII - UPF0178 protein YaiI

UniProt:	P0A8D3	Sequence MTIWVDADACPNVIKEILYRAAERMQMPLVLVANQSLRVPPSRFIRTLRVAAGFDVADNEIVRQCEAGDLVITADIPLAAEAIEKGAAALNPRGERYTPATIRERLTMRDFMDTLRASGIQTGGPDSLSQRDRQAFAAELEKWWLEVQRSRG	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13176
Length:	152 (149)
Sequences:	639
Seq/Len:	4.29

YAII
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
60_E	64_Q	3.531	1.00
82_A	87_A	2.929	1.00
80_A	84_E	2.768	1.00
82_A	89_A	2.679	1.00
5_V	18_L	2.566	1.00
2_T	30_V	2.536	1.00
60_E	63_R	2.163	1.00
27_M	144_W	2.032	1.00
19_Y	31_L	1.984	1.00
28_P	46_R	1.944	1.00
129_S	132_D	1.805	1.00
65_C	71_V	1.772	1.00
32_V	57_A	1.739	0.99
74_A	92_P	1.731	0.99
91_N	97_Y	1.718	0.99
24_R	141_E	1.681	0.99
119_G	122_T	1.643	0.99
59_N	81_E	1.617	0.99
26_Q	44_F	1.581	0.99
128_L	133_R	1.579	0.99
65_C	87_A	1.562	0.98
88_A	143_W	1.549	0.98
110_D	114_T	1.545	0.98
84_E	103_R	1.536	0.98
12_N	38_R	1.519	0.98
2_T	28_P	1.518	0.98
7_A	31_L	1.469	0.98
17_I	133_R	1.454	0.97
80_A	106_L	1.415	0.97
17_I	137_A	1.411	0.97
48_L	60_E	1.382	0.96
83_I	101_T	1.38	0.96
71_V	82_A	1.374	0.96
48_L	64_Q	1.359	0.96
56_V	59_N	1.336	0.95
134_Q	138_A	1.329	0.95
122_T	125_P	1.313	0.94
30_V	46_R	1.295	0.94
74_A	91_N	1.271	0.93
130_Q	133_R	1.264	0.93
131_R	135_A	1.247	0.92
4_W	60_E	1.241	0.92
19_Y	45_I	1.212	0.91
62_V	85_K	1.201	0.90
77_P	106_L	1.186	0.89
23_E	43_R	1.176	0.89
83_I	110_D	1.17	0.88
51_A	54_F	1.165	0.88
32_V	61_I	1.161	0.88
83_I	111_F	1.126	0.86
115_L	120_I	1.121	0.85
22_A	29_L	1.113	0.85
14_I	128_L	1.111	0.85
113_D	117_A	1.101	0.84
18_L	29_L	1.099	0.84
63_R	81_E	1.093	0.83
21_A	144_W	1.091	0.83
31_L	39_V	1.086	0.83
65_C	82_A	1.081	0.82
89_A	97_Y	1.08	0.82
3_I	18_L	1.075	0.82
135_A	142_K	1.067	0.81
13_V	133_R	1.043	0.79
57_A	61_I	1.026	0.78
72_I	85_K	1.014	0.76
96_R	139_E	1.008	0.76
37_L	115_L	1.006	0.76
5_V	31_L	1.004	0.75

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3hblA	4	0.9342	83.9	0.918	Contact Map	0.619
3u9tA	1	0.9342	80	0.921	Contact Map	0.53
3ouzA	2	0.9342	78.9	0.922	Contact Map	0.515
2vpqA	2	0.9342	75.9	0.924	Contact Map	0.528
3n6rA	6	0.9342	74.8	0.925	Contact Map	0.546
2w70A	2	0.9342	72.5	0.926	Contact Map	0.487
1w96A	3	0.9342	70.7	0.927	Contact Map	0.469
1ulzA	1	0.9342	64.4	0.93	Contact Map	0.518
1uqtA	2	0.9539	62.7	0.931	Contact Map	0.234
1o4wA	1	0.6711	60.9	0.932	Contact Map	0.46

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0109 seconds.