OPENSEQ.org - YQIC - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YQIC - Uncharacterized protein YqiC

UniProt:	Q46868	Sequence MIDPKKIEQIARQVHESMPKGIREFGEDVEKKIRQTLQAQLTRLDLVSREEFDVQTQVLLRTREKLALLEQRISELENRSTEIKKQPDPETLPPTL	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13031
Length:	96 (84)
Sequences:	382
Seq/Len:	4.55

YQIC
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
29_V	33_I	2.365	1.00
59_L	62_T	2.082	1.00
40_Q	44_L	1.95	1.00
55_Q	59_L	1.919	1.00
70_E	74_S	1.804	1.00
41_L	46_L	1.721	0.99
55_Q	62_T	1.703	0.99
64_E	68_L	1.634	0.99
58_V	62_T	1.575	0.99
62_T	66_L	1.528	0.98
14_V	33_I	1.515	0.98
60_L	64_E	1.507	0.98
2_I	5_K	1.488	0.98
26_G	56_T	1.392	0.97
1_M	18_M	1.349	0.96
65_K	70_E	1.341	0.96
26_G	30_E	1.331	0.95
72_R	77_E	1.324	0.95
52_F	62_T	1.315	0.95
58_V	66_L	1.314	0.95
72_R	76_L	1.3	0.95
30_E	76_L	1.297	0.94
53_D	57_Q	1.284	0.94
75_E	78_N	1.269	0.94
57_Q	72_R	1.26	0.93
62_T	65_K	1.24	0.93
13_Q	32_K	1.2	0.91
34_R	38_Q	1.172	0.90
73_I	76_L	1.152	0.88
20_K	28_D	1.146	0.88
52_F	65_K	1.13	0.87
58_V	65_K	1.119	0.86
15_H	26_G	1.114	0.86
43_R	47_V	1.107	0.86
58_V	61_R	1.089	0.84
28_D	57_Q	1.084	0.84
17_S	25_F	1.079	0.84
72_R	80_S	1.066	0.83
75_E	79_R	1.05	0.81
35_Q	39_A	1.028	0.79
55_Q	58_V	1.022	0.79
54_V	57_Q	1.011	0.78
28_D	54_V	1.005	0.77
67_A	82_E	1.005	0.77
47_V	52_F	1.002	0.77
10_I	64_E	1.001	0.77

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1go4E	4	0.6042	59.2	0.871	Contact Map	0.467
2w83C	2	0.6042	37	0.887	Contact Map	0.454
4iffA	4	0.8542	33.5	0.89	Contact Map	0.406
3gw6A	6	0.7083	33.5	0.89	Contact Map	0.663
3seoA	2	0.6979	24.1	0.897	Contact Map	0.432
3ghgA	4	0.9896	23.1	0.898	Contact Map	0.546
3ljmA	3	0.3229	17.3	0.904	Contact Map	0.603
3vkgA	2	0.7917	15.7	0.906	Contact Map	0.367
3iynQ	4	0.9375	15.3	0.906	Contact Map	0.538
2yy0A	4	0.5521	14.5	0.907	Contact Map	0.546

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.219 seconds.