OPENSEQ.org - SSUE - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

SSUE - FMN reductase (NADPH)

UniProt:	P80644	Sequence MRVITLAGSPRFPSRSSSLLEYAREKLNGLDVEVYHWNLQNFAPEDLLYARFDSPALKTFTEQLQQADGLIVATPVYKAAYSGALKTLLDLLPERALQGKVVLPLATGGTVAHLLAVDYALKPVLSALKAQEILHGVFADDSQVIDYHHRPQFTPNLQTRLDTALETFWQALHRRDVQVPDLLSLRGNAHA	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13708
Length:	191 (174)
Sequences:	2639
Seq/Len:	15.17

SSUE
Paralog alert: 0.59 [within 20: 0.11] - ratio of genomes with paralogs
Cluster includes: SSUE YIEF

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
35_Y	63_Q	4.245	1.00
2_R	33_E	3.494	1.00
4_I	67_A	2.821	1.00
80_A	120_A	2.689	1.00
62_E	66_Q	2.554	1.00
5_T	20_L	2.551	1.00
102_V	130_A	2.524	1.00
55_P	59_T	2.498	1.00
20_L	73_A	2.366	1.00
81_Y	124_V	2.301	1.00
125_L	130_A	2.296	1.00
86_K	90_D	2.213	1.00
7_A	17_S	2.173	1.00
3_V	69_G	2.073	1.00
58_K	62_E	1.989	1.00
72_V	102_V	1.981	1.00
106_A	114_L	1.927	1.00
26_K	162_D	1.866	1.00
69_G	168_F	1.813	1.00
64_L	92_L	1.75	1.00
103_L	164_A	1.749	1.00
155_P	159_T	1.746	1.00
60_F	88_L	1.732	1.00
98_Q	129_K	1.691	1.00
59_T	63_Q	1.672	1.00
64_L	70_L	1.651	1.00
16_S	107_T	1.64	1.00
3_V	32_V	1.589	1.00
104_P	117_V	1.585	1.00
145_I	151_P	1.565	1.00
38_N	41_N	1.539	1.00
17_S	21_E	1.533	1.00
89_L	128_L	1.515	1.00
120_A	123_P	1.51	1.00
103_L	168_F	1.503	1.00
17_S	38_N	1.478	1.00
24_R	36_H	1.469	1.00
145_I	148_H	1.464	1.00
148_H	151_P	1.449	1.00
83_G	90_D	1.448	1.00
77_Y	83_G	1.423	1.00
70_L	130_A	1.414	1.00
56_A	59_T	1.407	0.99
2_R	66_Q	1.399	0.99
157_L	160_R	1.368	0.99
23_A	105_L	1.357	0.99
81_Y	120_A	1.351	0.99
57_L	91_L	1.339	0.99
74_T	121_L	1.334	0.99
30_L	166_E	1.325	0.99
19_L	107_T	1.323	0.99
80_A	124_V	1.313	0.99
72_V	125_L	1.286	0.99
2_R	35_Y	1.282	0.99
7_A	20_L	1.269	0.99
5_T	73_A	1.263	0.99
102_V	125_L	1.263	0.99
21_E	24_R	1.258	0.99
23_A	71_I	1.254	0.99
74_T	106_A	1.221	0.98
23_A	161_L	1.215	0.98
55_P	58_K	1.206	0.98
62_E	65_Q	1.192	0.98
133_I	168_F	1.181	0.98
35_Y	67_A	1.171	0.98
135_H	167_T	1.165	0.97
158_Q	162_D	1.158	0.97
5_T	34_V	1.158	0.97
4_I	37_W	1.152	0.97
32_V	169_W	1.137	0.97
5_T	24_R	1.129	0.97
13_P	18_S	1.123	0.97
16_S	73_A	1.088	0.96
112_A	115_L	1.084	0.96
92_L	97_L	1.084	0.96
155_P	158_Q	1.062	0.95
127_A	134_L	1.048	0.94
5_T	36_H	1.034	0.94
104_P	125_L	1.022	0.93
70_L	97_L	1.009	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2fzvA	4	0.9791	100	0.412	Contact Map	0.81
2q62A	8	0.9738	100	0.445	Contact Map	0.841
4ltnA	1	1	100	0.457	Contact Map	0.755
2vzfA	1	0.9738	100	0.46	Contact Map	0.749
3svlA	2	0.9215	100	0.464	Contact Map	0.779
3u7rA	2	0.9267	100	0.465	Contact Map	0.832
3k1yA	6	0.8953	100	0.468	Contact Map	0.773
4hs4A	8	0.9476	100	0.472	Contact Map	0.787
3fvwA	2	0.911	100	0.479	Contact Map	0.832
1rttA	1	0.9215	100	0.479	Contact Map	0.754

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 1.3321 seconds.