OPENSEQ.org - EUTP - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

EUTP - Ethanolamine utilization protein EutP

UniProt:	P76556	Sequence MKRIAFVGSVGAGKTTLFNALQGNYTLARKTQAVEFNDKGDIDTPGEYFNHPRWYHALITTLQDVDMLIYVHGANDPESRLPAGLLDIGVSKRQIAVISKTDMPDADVAATRKLLLETGFEEPMFELNSHDPQSVQQLVDYLASLTKQEEAGEKTHHSE	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14191
Length:	159 (144)
Sequences:	170
Seq/Len:	1.18

EUTP
Paralog alert: 0.31 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
125_F	141_Y	3.005	1.00
102_D	128_N	2.7	1.00
69_I	97_V	2.328	0.99
112_R	126_E	2.263	0.99
19_N	28_A	2.109	0.98
136_Q	140_D	1.818	0.94
73_G	76_D	1.806	0.93
74_A	106_A	1.571	0.85
112_R	123_P	1.553	0.84
7_V	10_V	1.541	0.83
55_Y	85_L	1.524	0.82
86_L	89_G	1.458	0.78
81_L	123_P	1.448	0.78
15_T	19_N	1.439	0.77
71_V	81_L	1.43	0.76
32_Q	43_D	1.424	0.76
30_K	43_D	1.413	0.75
51_H	56_H	1.408	0.75
19_N	26_T	1.391	0.74
101_T	126_E	1.372	0.72
6_F	83_A	1.366	0.72
52_P	82_P	1.363	0.71
48_Y	79_S	1.348	0.70
34_V	137_Q	1.347	0.70
31_T	43_D	1.341	0.70
21_L	138_L	1.27	0.63
98_I	122_E	1.252	0.62
102_D	129_S	1.25	0.62
12_A	20_A	1.228	0.60
19_N	118_T	1.213	0.58
7_V	97_V	1.202	0.57
3_R	22_Q	1.19	0.56
4_I	69_I	1.184	0.55
44_T	58_L	1.182	0.55
11_G	53_R	1.18	0.55
95_I	141_Y	1.172	0.54
15_T	43_D	1.171	0.54
31_T	102_D	1.167	0.54
98_I	108_V	1.16	0.53
55_Y	95_I	1.147	0.52
38_D	124_M	1.147	0.52
62_L	89_G	1.107	0.48
113_K	135_V	1.105	0.48
100_K	136_Q	1.104	0.48
1_M	4_I	1.099	0.47
7_V	57_A	1.097	0.47
12_A	73_G	1.096	0.47
111_T	133_Q	1.094	0.47
10_V	29_R	1.086	0.46
85_L	89_G	1.082	0.46
9_S	84_G	1.082	0.46
18_F	41_D	1.08	0.45
82_P	116_L	1.07	0.44
2_K	127_L	1.067	0.44
30_K	47_E	1.066	0.44
10_V	51_H	1.064	0.44
48_Y	113_K	1.063	0.44
33_A	81_L	1.063	0.44
23_G	142_L	1.058	0.43
49_F	107_D	1.054	0.43
5_A	65_V	1.053	0.43
62_L	88_I	1.038	0.41
68_L	82_P	1.036	0.41
55_Y	100_K	1.033	0.41
44_T	57_A	1.031	0.41
69_I	95_I	1.031	0.41
60_T	63_Q	1.03	0.41
9_S	76_D	1.03	0.41
42_I	65_V	1.029	0.41
122_E	135_V	1.022	0.40
98_I	124_M	1.021	0.40
31_T	46_G	1.013	0.39
83_A	136_Q	1.012	0.39
36_F	56_H	1.011	0.39
66_D	71_V	1.003	0.38

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1zo1I	1	0.9686	99.8	0.693	Contact Map	0.334
4byrP	1	0.9623	99.8	0.694	Contact Map	0.285
4byxV	1	0.9686	99.8	0.696	Contact Map	0.28
4kjzA	4	0.9686	99.8	0.699	Contact Map	0.467
3j4jA	1	0.9686	99.8	0.699	Contact Map	0.302
4b3xA	1	0.9686	99.8	0.701	Contact Map	0.429
2e87A	1	0.9874	99.8	0.703	Contact Map	0.512
4b43A	1	0.9686	99.8	0.704	Contact Map	0.469
1g7sA	1	0.9686	99.8	0.704	Contact Map	0.418
4dheA	2	0.9874	99.8	0.708	Contact Map	0.348

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.1965 seconds.