OPENSEQ.org - ARNF - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

ARNF - Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF

UniProt:	P76474	Sequence MGLMWGLFSVIIASVAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLSVFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIFLPTTKQRY	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14094
Length:	128 (120)
Sequences:	494
Seq/Len:	4.12

ARNF
Paralog alert: 0.75 [within 20: 0.35] - ratio of genomes with paralogs
Cluster includes: ARNE ARNF

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
23_A	50_L	2.149	1.00
101_F	106_L	2.138	1.00
110_A	114_S	1.883	1.00
111_C	114_S	1.817	1.00
24_A	65_Y	1.712	0.99
111_C	118_L	1.689	0.99
16_A	80_L	1.647	0.99
17_Q	81_S	1.613	0.99
56_G	59_L	1.611	0.99
71_L	76_A	1.608	0.99
13_A	80_L	1.59	0.99
9_S	80_L	1.588	0.99
88_W	105_A	1.536	0.98
103_L	107_L	1.527	0.98
6_G	71_L	1.499	0.98
82_M	85_V	1.483	0.97
13_A	16_A	1.421	0.97
9_S	67_T	1.42	0.97
13_A	61_V	1.395	0.96
9_S	13_A	1.384	0.96
89_I	93_V	1.314	0.94
17_Q	64_W	1.307	0.94
90_A	94_L	1.283	0.93
64_W	77_Y	1.279	0.93
23_A	105_A	1.271	0.92
60_S	80_L	1.267	0.92
56_G	119_I	1.264	0.92
21_G	118_L	1.25	0.92
79_L	84_Y	1.242	0.91
3_L	7_L	1.231	0.91
13_A	83_S	1.215	0.90
23_A	53_G	1.189	0.89
88_W	116_L	1.186	0.89
51_L	59_L	1.169	0.88
104_K	107_L	1.169	0.88
20_L	83_S	1.162	0.87
93_V	107_L	1.155	0.87
13_A	67_T	1.152	0.87
102_S	105_A	1.141	0.86
94_L	98_E	1.107	0.84
51_L	98_E	1.101	0.83
84_Y	119_I	1.097	0.83
88_W	91_S	1.096	0.83
6_G	60_S	1.091	0.82
82_M	91_S	1.086	0.82
21_G	78_A	1.08	0.81
9_S	84_Y	1.077	0.81
6_G	79_L	1.076	0.81
21_G	24_A	1.053	0.79
23_A	84_Y	1.052	0.79
9_S	57_Y	1.049	0.79
13_A	60_S	1.042	0.78
64_W	79_L	1.028	0.77
18_L	22_F	1.022	0.76
109_V	113_M	1.022	0.76
13_A	20_L	1.018	0.76
10_V	14_S	1.016	0.76
13_A	71_L	1.013	0.75
17_Q	77_Y	1.01	0.75
27_L	73_L	1.009	0.75

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2i68A	2	0.8438	99.7	0.488	Contact Map	0.033
3b5dA	2	0.8438	99.7	0.488	Contact Map	0.07
2gfpA	2	0.9688	1.7	0.948	Contact Map	0.208
3j01B	1	0.4375	1	0.954	Contact Map	0.19
3ar4A	1	0.7656	0.9	0.956	Contact Map	0.568
4hg6A	1	0.6953	0.8	0.958	Contact Map	0.147
2lk9A	1	0.2266	0.8	0.958	Contact Map	0.026
3o7qA	1	0.9922	0.7	0.958	Contact Map	0.344
2l9uA	2	0.2969	0.7	0.96	Contact Map	0.084
1q90A	1	0.3359	0.6	0.96	Contact Map	0.759

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.2001 seconds.