OPENSEQ.org - PAAB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

PAAB - 1,2-phenylacetyl-CoA epoxidase, subunit B

UniProt:	P76078	Sequence MSNVYWPLYEVFVRGKQGLSHRHVGSLHAADERMALENARDAYTRRSEGCSIWVVKASEIVASQPEERGEFFDPAESKVYRHPTFYTIPDGIEHM	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG14299
Length:	95 (93)
Sequences:	146
Seq/Len:	1.57

PAAB
Paralog alert: 0.02 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
9_Y	32_E	3.645	1.00
56_K	59_E	3.556	1.00
11_V	54_V	2.21	0.99
90_D	95_M	1.881	0.97
20_S	24_V	1.582	0.90
47_S	75_A	1.53	0.88
72_F	94_H	1.481	0.86
64_Q	70_E	1.475	0.86
17_Q	71_F	1.471	0.86
58_S	66_E	1.433	0.84
30_A	33_R	1.421	0.83
34_M	38_N	1.392	0.81
85_F	89_P	1.36	0.79
22_R	93_E	1.331	0.77
69_G	76_E	1.303	0.75
6_W	16_K	1.3	0.74
15_G	22_R	1.292	0.74
50_C	77_S	1.208	0.66
17_Q	64_Q	1.206	0.66
42_A	66_E	1.197	0.65
9_Y	24_V	1.192	0.65
7_P	62_A	1.165	0.62
5_Y	57_A	1.154	0.61
37_E	64_Q	1.142	0.60
30_A	37_E	1.132	0.59
88_I	93_E	1.127	0.59
16_K	47_S	1.122	0.58
74_P	89_P	1.112	0.57
56_K	73_D	1.111	0.57
20_S	91_G	1.105	0.56
74_P	85_F	1.097	0.55
74_P	83_P	1.093	0.55
47_S	73_D	1.09	0.55
20_S	38_N	1.087	0.54
15_G	91_G	1.087	0.54
16_K	86_Y	1.075	0.53
64_Q	73_D	1.056	0.51
17_Q	22_R	1.052	0.51
69_G	77_S	1.048	0.50
22_R	69_G	1.038	0.49
14_R	26_S	1.036	0.49
30_A	34_M	1.033	0.49
7_P	65_P	1.032	0.49
17_Q	59_E	1.029	0.48
16_K	36_L	1.029	0.48
9_Y	64_Q	1.028	0.48
42_A	83_P	1.026	0.48
24_V	38_N	1.014	0.47
71_F	91_G	1.005	0.46
28_H	62_A	1	0.45

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
4iitB	1	1	100	0.163	Contact Map	0.286
3egrA	2	1	100	0.171	Contact Map	0.35
2gu3A	1	0.3895	5	0.956	Contact Map	0.011
3myrB	4	0.8632	5	0.956	Contact Map	0.116
2rr3B	1	0.3895	5	0.956	Contact Map	0.032
2d9bA	1	0.6947	4.5	0.957	Contact Map	0.24
2xziA	2	0.4316	4.1	0.958	Contact Map	0
3kreA	1	0.7895	3.7	0.959	Contact Map	0
4bzyA	3	0.8316	3.2	0.96	Contact Map	0.189
2btzA	1	0.8316	3.2	0.96	Contact Map	0.025

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 2.0565 seconds.