OPENSEQ.org - YCGI - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YCGI - Putative uncharacterized protein YcgI

UniProt:	P76000	Sequence MNTIHLRCLFRMNPLVWCLRADVAAELRSLRRYYHLSNGMESKSVDTRSIYRELGATLSYNMRLGNGMEXEPWLKAAVRKEFVDDNRVKVNNDGNFVNDLSGRRGIYQAAIKASFSSTFSGHLGVGYSHGAGVESPWNAVAGVNWSF	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13890
Length:	147 (144)
Sequences:	162
Seq/Len:	1.12

YCGI
Paralog alert: 0.58 [within 20: 0.03] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
19_L	58_L	2.201	0.98
80_K	103_R	2.047	0.97
53_E	106_I	1.834	0.93
78_V	103_R	1.811	0.93
9_L	21_A	1.731	0.90
22_D	53_E	1.696	0.89
36_L	86_N	1.632	0.87
53_E	77_A	1.613	0.86
119_F	143_V	1.566	0.83
60_Y	143_V	1.557	0.83
19_L	23_V	1.546	0.82
24_A	53_E	1.504	0.80
52_R	82_F	1.502	0.80
72_P	136_P	1.496	0.79
58_L	141_A	1.491	0.79
6_L	63_R	1.448	0.76
105_G	134_E	1.431	0.75
127_Y	134_E	1.391	0.72
26_E	40_M	1.343	0.68
114_S	139_A	1.335	0.68
19_L	141_A	1.315	0.66
22_D	86_N	1.299	0.64
73_W	108_Q	1.298	0.64
40_M	62_M	1.283	0.63
34_Y	137_W	1.277	0.62
86_N	96_F	1.265	0.61
58_L	70_X	1.264	0.61
18_C	59_S	1.252	0.60
106_I	145_W	1.232	0.58
105_G	129_H	1.227	0.58
95_N	121_G	1.204	0.56
135_S	138_N	1.191	0.55
100_L	107_Y	1.188	0.54
24_A	29_S	1.186	0.54
31_R	147_F	1.181	0.54
37_S	40_M	1.181	0.54
72_P	82_F	1.178	0.53
124_G	138_N	1.167	0.52
6_L	25_A	1.166	0.52
103_R	124_G	1.156	0.51
79_R	83_V	1.145	0.50
33_Y	92_N	1.141	0.50
85_D	97_V	1.136	0.49
49_S	81_E	1.125	0.48
51_Y	127_Y	1.097	0.46
4_I	23_V	1.095	0.45
113_A	136_P	1.093	0.45
59_S	108_Q	1.09	0.45
112_K	124_G	1.089	0.45
42_S	136_P	1.087	0.45
33_Y	117_S	1.082	0.44
19_L	143_V	1.081	0.44
9_L	22_D	1.077	0.44
115_F	123_L	1.072	0.43
28_R	48_R	1.071	0.43
5_H	99_D	1.063	0.42
45_V	81_E	1.063	0.42
22_D	51_Y	1.048	0.41
132_G	147_F	1.046	0.41
41_E	132_G	1.042	0.40
36_L	96_F	1.042	0.40
41_E	65_G	1.042	0.40
23_V	114_S	1.038	0.40
42_S	111_I	1.037	0.40
57_T	77_A	1.036	0.40
96_F	101_S	1.033	0.40
42_S	138_N	1.029	0.39
70_X	143_V	1.027	0.39
73_W	144_N	1.026	0.39
39_G	136_P	1.024	0.39
73_W	145_W	1.019	0.38
51_Y	92_N	1.019	0.38
104_R	109_A	1.018	0.38
36_L	143_V	1.011	0.38
7_R	18_C	1.01	0.37
42_S	122_H	1.009	0.37

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3qq2A	3	0.9932	99.9	0.548	Contact Map	0.226
3sltA	1	0.9864	99.9	0.583	Contact Map	0.227
3aehA	2	0.9864	99.9	0.588	Contact Map	0.292
3kvnX	2	0.966	99.9	0.62	Contact Map	0.177
1uynX	1	0.9592	99.8	0.628	Contact Map	0.169
2x27X	1	0.9524	98.4	0.824	Contact Map	0.19
2jmmA	1	0.8435	98.1	0.836	Contact Map	0.117
2k0lA	1	0.9116	98.1	0.836	Contact Map	0.07
3qraA	1	0.8571	98.1	0.838	Contact Map	0.133
1ormA	1	0.8571	98	0.839	Contact Map	0.093

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 1.1852 seconds.