OPENSEQ.org - HIGA - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

HIGA - Antitoxin HigA

UniProt:	P67701	Sequence MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGGIAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12724
Length:	138 (118)
Sequences:	389
Seq/Len:	3.30

HIGA
Paralog alert: 0.29 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
36_L	49_L	3.789	1.00
79_G	113_G	3.6	1.00
37_V	57_I	3.567	1.00
95_L	108_S	2.881	1.00
100_E	128_R	2.319	1.00
86_T	90_Q	2.316	1.00
40_L	50_L	2.243	1.00
105_S	108_S	2.164	1.00
117_L	122_A	2.106	1.00
27_E	30_Y	2.009	1.00
59_A	63_S	1.895	1.00
106_M	109_R	1.634	0.98
109_R	114_K	1.605	0.98
100_E	129_F	1.53	0.97
99_P	107_V	1.499	0.96
55_A	59_A	1.403	0.94
87_L	91_Y	1.355	0.93
15_T	19_P	1.347	0.92
15_T	18_A	1.321	0.91
29_Q	52_L	1.304	0.91
23_G	52_L	1.302	0.91
84_I	126_A	1.3	0.91
95_L	105_S	1.28	0.90
120_E	124_K	1.265	0.89
13_K	18_A	1.252	0.88
81_I	113_G	1.244	0.88
84_I	87_L	1.244	0.88
37_V	50_L	1.234	0.87
49_L	129_F	1.233	0.87
84_I	131_I	1.231	0.87
93_L	128_R	1.228	0.87
25_Q	46_E	1.224	0.87
107_V	129_F	1.184	0.84
41_L	50_L	1.182	0.84
134_A	137_I	1.169	0.83
87_L	90_Q	1.154	0.82
82_A	85_R	1.14	0.81
123_K	137_I	1.133	0.80
37_V	40_L	1.128	0.80
27_E	31_T	1.12	0.79
15_T	20_F	1.118	0.79
13_K	16_A	1.112	0.79
31_T	35_E	1.11	0.78
91_Y	128_R	1.102	0.78
99_P	103_S	1.095	0.77
94_T	127_T	1.093	0.77
13_K	17_V	1.091	0.77
31_T	45_P	1.074	0.75
93_L	107_V	1.069	0.75
119_L	132_S	1.062	0.74
122_A	137_I	1.061	0.74
26_N	59_A	1.052	0.73
56_K	109_R	1.045	0.72
121_H	136_F	1.043	0.72
59_A	82_A	1.042	0.72
50_L	57_I	1.026	0.70
97_D	125_L	1.024	0.70

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2ictA	1	0.4855	98.4	0.781	Contact Map	0.531
2ebyA	2	0.5	98.4	0.782	Contact Map	0.628
3trbA	2	0.5217	98.3	0.786	Contact Map	0.553
1y7yA	2	0.5217	98.3	0.788	Contact Map	0.463
3fmyA	1	0.5	98.3	0.788	Contact Map	0.469
3vk0A	3	0.5797	98.3	0.788	Contact Map	0.553
2a6cA	2	0.558	98.3	0.789	Contact Map	0.471
1y9qA	1	0.4855	98.3	0.789	Contact Map	0.509
3qwgA	2	0.4638	98.3	0.79	Contact Map	0.425
3qq6A	2	0.5	98.3	0.79	Contact Map	0.541

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.3143 seconds.