OPENSEQ.org - YHEU - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YHEU - UPF0270 protein YheU

UniProt:	P67624	Sequence MLIPWQDLSPETLENLIESFVLREGTDYGEHERTLEQKVADVKRQLQCGEAVLVWSELHETVNIMPRSQFRE	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12905
Length:	72 (71)
Sequences:	178
Seq/Len:	2.51

YHEU
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
9_S	12_T	2.702	1.00
27_D	32_E	2.463	1.00
18_E	39_V	2.126	1.00
22_L	56_S	2.027	0.99
36_E	40_A	1.863	0.99
3_I	53_L	1.789	0.98
23_R	27_D	1.748	0.98
8_L	53_L	1.732	0.98
19_S	55_W	1.591	0.96
41_D	55_W	1.559	0.95
22_L	59_H	1.473	0.93
17_I	42_V	1.454	0.93
37_Q	55_W	1.396	0.90
16_L	62_V	1.329	0.87
10_P	14_E	1.315	0.87
2_L	52_V	1.304	0.86
56_S	59_H	1.276	0.84
20_F	64_I	1.259	0.83
33_R	41_D	1.239	0.82
22_L	58_L	1.2	0.79
1_M	57_E	1.196	0.79
16_L	46_L	1.188	0.78
21_V	39_V	1.153	0.75
8_L	51_A	1.148	0.75
53_L	66_P	1.115	0.71
21_V	42_V	1.079	0.68
5_W	15_N	1.076	0.68
2_L	5_W	1.054	0.65
20_F	43_K	1.036	0.63
12_T	15_N	1.036	0.63
28_Y	38_K	1.021	0.62
24_E	58_L	1.017	0.61
26_T	29_G	1.016	0.61
14_E	47_Q	1.012	0.61

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1y0nA	1	0.9861	100	0.041	Contact Map	0.53
1snnA	2	0.5139	34.8	0.891	Contact Map	0.146
1tksA	2	0.5556	28.8	0.895	Contact Map	0
4bwpA	2	0.9861	25.3	0.898	Contact Map	0.182
3mioA	2	0.5556	24.4	0.899	Contact Map	0.117
4i14A	2	0.5556	23.4	0.9	Contact Map	0
4ffjA	1	0.5417	22.3	0.901	Contact Map	0
3onhA	1	0.9306	15.9	0.907	Contact Map	0.071
2nysA	2	0.75	15.6	0.907	Contact Map	0.303
1g57A	2	0.6806	15.6	0.907	Contact Map	0.08

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.6026 seconds.