OPENSEQ.org - YQFB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YQFB - UPF0267 protein YqfB

UniProt:	P67603	Sequence MQPNDITFFQRFQDDILAGRKTITIRDESESHFKTGDVLRVGRFEDDGYFCTIEVTATSTVTLDTLTEKHAEQENMTLTELKKVIADIYPGQTQFYVIEFKCL	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13078
Length:	103 (103)
Sequences:	116
Seq/Len:	1.13

YQFB
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
25_I	97_V	2.297	0.99
39_L	55_V	2.021	0.97
54_E	101_K	1.938	0.96
15_D	75_N	1.72	0.90
5_D	47_D	1.649	0.88
32_H	54_E	1.624	0.86
38_V	67_T	1.511	0.81
12_F	15_D	1.496	0.80
6_I	32_H	1.496	0.80
43_R	46_D	1.485	0.79
43_R	63_L	1.478	0.78
33_F	39_L	1.472	0.78
46_D	52_T	1.466	0.78
10_Q	34_K	1.463	0.77
9_F	54_E	1.46	0.77
27_D	30_E	1.452	0.77
29_S	80_E	1.434	0.75
37_D	100_F	1.42	0.74
15_D	76_M	1.395	0.73
12_F	50_F	1.343	0.68
28_E	61_V	1.333	0.68
12_F	75_N	1.328	0.67
50_F	84_V	1.324	0.67
5_D	42_G	1.286	0.64
39_L	53_I	1.256	0.61
33_F	55_V	1.253	0.61
12_F	66_L	1.241	0.59
11_R	50_F	1.223	0.58
43_R	49_Y	1.209	0.56
36_G	54_E	1.191	0.55
56_T	60_T	1.169	0.53
16_I	88_I	1.156	0.51
23_I	73_Q	1.15	0.51
99_E	103_L	1.111	0.47
23_I	78_L	1.11	0.47
73_Q	78_L	1.11	0.47
19_G	32_H	1.105	0.47
86_A	94_Q	1.103	0.46
66_L	75_N	1.098	0.46
95_F	99_E	1.081	0.44
94_Q	99_E	1.078	0.44
4_N	37_D	1.067	0.43
43_R	48_G	1.064	0.43
40_R	43_R	1.062	0.42
32_H	61_V	1.03	0.40
77_T	87_D	1.026	0.39
20_R	53_I	1.023	0.39
25_I	91_G	1.02	0.39
23_I	85_I	1.02	0.39
73_Q	85_I	1.02	0.39
56_T	65_T	1.019	0.39
6_I	53_I	1.019	0.39
15_D	50_F	1.017	0.38
64_D	93_T	1.008	0.38
57_A	61_V	1.003	0.37
17_L	75_N	1.002	0.37

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1te7A	1	1	100	0.443	Contact Map	0.174
3s9xA	1	0.9903	99.8	0.631	Contact Map	0.205
1t62A	2	0.9903	99.8	0.632	Contact Map	0.187
1xneA	1	0.9417	99.5	0.706	Contact Map	0.153
3iuwA	2	0.7184	97.9	0.835	Contact Map	0.356
2z0tA	4	0.9417	94.6	0.885	Contact Map	0.305
2kkuA	1	1	92.7	0.894	Contact Map	0.271
2dp9A	1	0.8932	83.1	0.911	Contact Map	0.237
4e8bA	1	0.9417	17.6	0.944	Contact Map	0.131
1wo9A	1	0.2913	15.6	0.946	Contact Map	0

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.1818 seconds.