OPENSEQ.org - YHCO - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YHCO - Uncharacterized protein YhcO

UniProt:	P64616	Sequence MNIYTFDFDEIESQEDFYRDFSQTFGLAKDKVRDLDSLWDVLMNDVLPLPLEIEFVHLGEKTRRRFGALILLFDEAEEELEGHLRFNVRH	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12821
Length:	90 (89)
Sequences:	134
Seq/Len:	1.51

YHCO
Paralog alert: 0.03 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
18_Y	31_K	3.046	1.00
21_F	25_F	1.926	0.97
4_Y	82_G	1.834	0.96
34_D	45_D	1.735	0.94
32_V	37_S	1.703	0.94
53_I	73_F	1.592	0.90
47_L	51_L	1.514	0.87
8_F	18_Y	1.506	0.87
41_V	46_V	1.443	0.83
75_E	80_L	1.322	0.75
58_L	70_I	1.31	0.74
12_E	33_R	1.303	0.74
20_D	23_Q	1.287	0.72
17_F	66_F	1.286	0.72
2_N	43_M	1.286	0.72
31_K	37_S	1.265	0.70
8_F	66_F	1.264	0.70
7_D	57_H	1.26	0.70
49_L	80_L	1.257	0.70
55_F	86_F	1.241	0.68
15_E	26_G	1.23	0.67
27_L	54_E	1.223	0.67
28_A	33_R	1.212	0.66
31_K	43_M	1.21	0.65
76_A	80_L	1.21	0.65
40_D	43_M	1.195	0.64
8_F	55_F	1.18	0.63
49_L	76_A	1.167	0.61
9_D	57_H	1.155	0.60
6_F	18_Y	1.153	0.60
9_D	56_V	1.153	0.60
36_D	66_F	1.125	0.57
37_S	44_N	1.119	0.57
4_Y	47_L	1.116	0.56
49_L	82_G	1.114	0.56
34_D	37_S	1.109	0.55
49_L	57_H	1.103	0.55
26_G	30_D	1.074	0.52
4_Y	74_D	1.074	0.52
53_I	69_L	1.072	0.52
6_F	25_F	1.05	0.49
52_E	72_L	1.048	0.49
6_F	49_L	1.043	0.49
15_E	22_S	1.036	0.48
13_S	24_T	1.03	0.47
17_F	50_P	1.03	0.47
49_L	75_E	1.028	0.47
24_T	37_S	1.026	0.47
43_M	46_V	1.02	0.46
37_S	40_D	1.004	0.45
20_D	62_T	1.003	0.45

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2cx6A	2	0.9889	99.9	0.21	Contact Map	0.384
2za4B	2	0.9667	99.9	0.292	Contact Map	0.396
1wvvA	2	0.3889	57.2	0.884	Contact Map	0.218
3hbeX	1	0.3889	52.7	0.888	Contact Map	0.383
2cjlA	2	0.3889	48.6	0.89	Contact Map	0.219
2z37A	4	0.4667	26.2	0.905	Contact Map	0.258
3cqlA	2	0.4667	24.2	0.907	Contact Map	0.163
1wudA	3	0.8778	23.7	0.907	Contact Map	0.224
3w3eA	2	0.4667	23	0.908	Contact Map	0.352
2dkvA	1	0.5778	16.6	0.913	Contact Map	0.254

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.4851 seconds.