OPENSEQ.org - HIGB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

HIGB - mRNA interferase HigB

UniProt:	P64578	Sequence MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKCYIREVMTHKEYDFFTAVHRTKGKK	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12725
Length:	104 (96)
Sequences:	324
Seq/Len:	3.38

HIGB
Paralog alert: 0.16 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
63_G	66_E	3.054	1.00
62_V	69_V	2.913	1.00
2_H	79_K	2.231	1.00
20_K	24_V	2.167	1.00
58_Y	75_F	2.01	1.00
30_I	80_C	1.922	1.00
18_Q	61_N	1.758	0.99
74_F	83_R	1.724	0.99
42_K	49_D	1.707	0.99
34_Y	78_Q	1.645	0.98
3_L	82_I	1.629	0.98
6_Q	27_G	1.582	0.98
26_L	60_F	1.549	0.97
30_I	35_F	1.524	0.97
37_K	40_S	1.492	0.96
51_F	54_L	1.488	0.96
57_H	86_M	1.487	0.96
57_H	84_E	1.452	0.96
72_M	83_R	1.439	0.95
49_D	59_V	1.376	0.94
13_A	24_V	1.375	0.94
9_L	48_L	1.35	0.93
37_K	90_E	1.338	0.92
27_G	89_K	1.285	0.90
86_M	94_F	1.279	0.90
10_K	13_A	1.261	0.89
36_K	78_Q	1.223	0.87
21_T	24_V	1.217	0.87
42_K	64_G	1.214	0.87
56_K	75_F	1.187	0.85
12_A	85_V	1.183	0.85
49_D	61_N	1.148	0.82
48_L	58_Y	1.143	0.82
12_A	67_L	1.117	0.80
9_L	13_A	1.106	0.79
5_T	8_A	1.101	0.78
29_T	45_F	1.1	0.78
46_P	90_E	1.092	0.78
7_K	11_D	1.088	0.77
18_Q	67_L	1.084	0.77
23_L	62_V	1.073	0.76
45_F	49_D	1.067	0.75
36_K	40_S	1.064	0.75
30_I	41_L	1.056	0.74
23_L	85_V	1.043	0.73
84_E	94_F	1.042	0.73
4_I	79_K	1.027	0.71
19_H	67_L	1.021	0.71
42_K	47_S	1.02	0.70

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3g5oB	2	0.7788	62.3	0.904	Contact Map	0.405
2a6sA	4	0.7404	54.6	0.909	Contact Map	0.531
3oeiC	8	0.7404	53.3	0.909	Contact Map	0.435
1wmiA	2	0.7885	52.7	0.91	Contact Map	0.569
1z8mA	1	0.7596	44.5	0.914	Contact Map	0.324
2otrA	1	0.875	42.2	0.915	Contact Map	0.446
3bpqB	2	0.8077	40.6	0.916	Contact Map	0.519
2kheA	1	0.7885	36	0.919	Contact Map	0.468
4fxiA	3	0.8365	31.1	0.921	Contact Map	0.448
3atrA	1	0.4038	15.3	0.932	Contact Map	0.227

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 1.859 seconds.