OPENSEQ.org - YEAR - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YEAR - Uncharacterized protein YeaR

UniProt:	P64488	Sequence MLQIPQNYIHTRSTPFWNKQTAPAGIFERHLDKGTRPGVYPRLSVMHGAVKYLGYADEHSAEPDQVILIEAGQFAVFPPEKWHNIEAMTDDTYFNIDFFVAPEVLMEGAQQRKVIHNGK	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13504
Length:	119 (112)
Sequences:	159
Seq/Len:	1.42

YEAR
Paralog alert: 0.21 [within 20: 0.01] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
19_K	90_D	2.819	1.00
42_R	99_F	2.137	0.99
41_P	45_V	1.979	0.98
43_L	85_I	1.853	0.96
10_H	43_L	1.757	0.94
53_L	86_E	1.689	0.92
83_H	98_F	1.676	0.92
54_G	81_K	1.668	0.92
22_A	27_F	1.628	0.91
44_S	76_V	1.619	0.90
34_G	82_W	1.552	0.88
67_I	85_I	1.524	0.86
35_T	98_F	1.519	0.86
85_I	88_M	1.517	0.86
44_S	99_F	1.473	0.84
51_K	88_M	1.385	0.78
47_H	93_Y	1.378	0.78
51_K	86_E	1.367	0.77
54_G	86_E	1.344	0.75
76_V	99_F	1.272	0.69
54_G	88_M	1.238	0.66
11_T	100_V	1.218	0.64
45_V	86_E	1.213	0.64
59_H	104_V	1.21	0.64
30_H	35_T	1.203	0.63
40_Y	55_Y	1.199	0.63
37_P	66_V	1.193	0.62
18_N	93_Y	1.176	0.60
35_T	83_H	1.168	0.60
42_R	55_Y	1.155	0.58
42_R	57_D	1.142	0.57
74_F	95_N	1.136	0.56
77_F	85_I	1.125	0.55
69_I	72_G	1.123	0.55
56_A	85_I	1.12	0.55
52_Y	98_F	1.119	0.55
51_K	54_G	1.117	0.54
30_H	82_W	1.104	0.53
106_M	112_R	1.099	0.53
89_T	99_F	1.092	0.52
14_T	47_H	1.069	0.50
7_N	101_A	1.061	0.49
30_H	83_H	1.059	0.49
102_P	110_Q	1.058	0.48
70_E	73_Q	1.057	0.48
12_R	26_I	1.054	0.48
1_M	113_K	1.05	0.48
12_R	96_I	1.05	0.48
75_A	94_F	1.048	0.47
46_M	95_N	1.038	0.46
39_V	59_H	1.038	0.46
39_V	108_G	1.024	0.45
3_Q	115_I	1.022	0.45
55_Y	77_F	1.01	0.44
9_I	90_D	1.009	0.43
110_Q	115_I	1.001	0.43

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3bb6A	4	1	100	0.061	Contact Map	0.342
3dl3A	8	0.9664	100	0.144	Contact Map	0.402
3m70A	1	0.9412	99.9	0.554	Contact Map	0.389
2pa7A	2	0.9244	86.5	0.899	Contact Map	0.352
4mzuA	12	0.9412	84.3	0.902	Contact Map	0.323
3d0jA	1	0.9496	82.8	0.904	Contact Map	0.313
3eqeA	2	0.9496	82.2	0.904	Contact Map	0.221
2opkA	4	0.7395	77.6	0.909	Contact Map	0.262
3st7A	1	0.8571	73	0.912	Contact Map	0.324
2gm6A	1	0.958	71.3	0.913	Contact Map	0.125

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.5194 seconds.