OPENSEQ.org - RISB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

RISB - 6,7-dimethyl-8-ribityllumazine synthase

UniProt:	P61714	Sequence MNIIEANVATPDARVAITIARFNNFINDSLLEGAIDALKRIGQVKDENITVVWVPGAYELPLAAGALAKTGKYDAVIALGTVIRGGTAHFEYVAGGASNGLAHVAQDSEIPVAFGVLTTESIEQAIERAGTKAGNKGAEAALTALEMINVLKAIKA	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG11322
Length:	156 (154)
Sequences:	1585
Seq/Len:	10.29

RISB
Paralog alert: 0.05 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
16_A	67_L	3.22	1.00
75_A	144_A	3.168	1.00
31_L	51_V	3.051	1.00
103_H	107_D	2.792	1.00
50_T	73_Y	2.617	1.00
37_A	138_A	2.398	1.00
64_A	78_A	2.139	1.00
13_A	148_I	2.135	1.00
52_V	67_L	2.048	1.00
19_I	31_L	2.044	1.00
35_I	39_K	2.025	1.00
25_F	126_I	1.96	1.00
86_G	127_E	1.956	1.00
65_G	107_D	1.923	1.00
84_R	120_E	1.92	1.00
10_T	44_V	1.91	1.00
78_A	101_L	1.902	1.00
136_K	139_E	1.857	1.00
82_V	93_V	1.828	1.00
24_N	28_D	1.751	1.00
39_K	46_D	1.737	1.00
60_L	116_V	1.704	1.00
96_G	99_N	1.694	1.00
88_A	91_E	1.68	1.00
69_K	109_E	1.633	1.00
12_D	48_N	1.62	1.00
91_E	94_A	1.617	1.00
38_L	44_V	1.586	1.00
97_A	116_V	1.585	1.00
65_G	69_K	1.556	1.00
99_N	103_H	1.542	1.00
21_R	146_E	1.509	1.00
15_V	148_I	1.49	1.00
113_A	143_T	1.48	1.00
36_D	40_R	1.466	1.00
37_A	142_L	1.454	1.00
62_L	151_L	1.443	1.00
26_I	81_T	1.392	0.99
28_D	53_W	1.382	0.99
38_L	77_I	1.379	0.99
63_A	151_L	1.365	0.99
38_L	141_A	1.357	0.99
90_F	94_A	1.349	0.99
58_Y	114_F	1.347	0.99
88_A	120_E	1.323	0.99
54_V	63_A	1.319	0.99
123_E	127_E	1.306	0.99
19_I	51_V	1.293	0.99
32_E	36_D	1.286	0.99
61_P	100_G	1.269	0.99
66_A	155_K	1.262	0.99
24_N	53_W	1.255	0.99
19_I	27_N	1.236	0.98
66_A	109_E	1.233	0.98
25_F	122_I	1.225	0.98
62_L	105_A	1.218	0.98
65_G	109_E	1.203	0.98
26_I	126_I	1.197	0.98
64_A	76_V	1.178	0.98
122_I	131_T	1.145	0.97
4_I	50_T	1.142	0.97
88_A	92_Y	1.135	0.97
115_G	140_A	1.127	0.97
65_G	106_Q	1.125	0.97
41_I	145_L	1.118	0.96
45_K	48_N	1.116	0.96
18_T	64_A	1.116	0.96
2_N	50_T	1.101	0.96
129_A	135_N	1.1	0.96
29_S	32_E	1.081	0.95
14_R	48_N	1.076	0.95
7_N	153_A	1.074	0.95
68_A	76_V	1.069	0.95
113_A	140_A	1.045	0.94
18_T	60_L	1.012	0.93
79_L	115_G	1.008	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
1hqkA	5	0.9872	100	0.038	Contact Map	0.821
1rvvA	30	0.9872	100	0.04	Contact Map	0.833
3nq4A	30	1	100	0.04	Contact Map	0.77
1c2yA	20	0.9872	100	0.053	Contact Map	0.8
1kz1A	5	0.9744	100	0.061	Contact Map	0.817
2obxA	10	0.9872	100	0.063	Contact Map	0.683
1ejbA	5	0.9872	100	0.072	Contact Map	0.769
1di0A	5	0.9808	100	0.072	Contact Map	0.643
1c41A	10	0.9936	100	0.075	Contact Map	0.739
2i0fA	5	0.9744	100	0.083	Contact Map	0.767

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 1.2387 seconds.