OPENSEQ.org - HSLJ - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

HSLJ - Heat shock protein HslJ

UniProt:	P52644	Sequence MKKVAAFVALSLLMAGCVSNDKIAVTPEQLQHHRFVLESVNGKPVTSDKNPPEISFGEKMMISGSMCNRFSGEGKLSNGELTAKGLAMTRMMCANPQLNELDNTISEMLKEGAQVDLTANQLTLATAKQTLTYKLADLMN	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13181
Length:	140 (136)
Sequences:	509
Seq/Len:	3.74

HSLJ
Paralog alert: 0.05 [within 20: 0.01] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
71_S	87_A	4.386	1.00
72_G	86_L	3.352	1.00
69_R	91_M	2.984	1.00
66_M	102_D	2.692	1.00
66_M	106_S	2.557	1.00
62_I	83_A	2.112	1.00
67_C	93_C	2.075	1.00
102_D	106_S	1.877	1.00
103_N	107_E	1.757	0.99
62_I	86_L	1.748	0.99
56_F	83_A	1.652	0.99
66_M	88_M	1.646	0.99
83_A	112_G	1.518	0.97
34_R	53_E	1.484	0.97
37_L	40_V	1.463	0.97
41_N	129_Q	1.449	0.96
56_F	74_G	1.423	0.96
14_M	17_C	1.411	0.96
126_T	129_Q	1.351	0.94
63_S	71_S	1.349	0.94
88_M	106_S	1.32	0.93
72_G	87_A	1.291	0.92
5_A	19_S	1.285	0.92
53_E	105_I	1.277	0.91
37_L	105_I	1.266	0.91
70_F	105_I	1.254	0.90
81_L	112_G	1.235	0.90
34_R	51_P	1.217	0.89
39_S	44_P	1.212	0.88
56_F	62_I	1.211	0.88
72_G	92_M	1.178	0.86
32_H	137_D	1.171	0.86
2_K	8_V	1.166	0.86
64_G	87_A	1.145	0.84
56_F	82_T	1.129	0.83
30_L	132_T	1.125	0.83
33_H	135_L	1.125	0.83
83_A	114_Q	1.121	0.82
106_S	134_K	1.116	0.82
89_T	92_M	1.115	0.82
29_Q	109_L	1.105	0.81
126_T	130_T	1.1	0.81
74_G	112_G	1.087	0.80
35_F	67_C	1.085	0.79
2_K	86_L	1.085	0.79
46_T	101_L	1.083	0.79
32_H	57_G	1.078	0.79
44_P	47_S	1.069	0.78
38_E	101_L	1.064	0.78
60_M	74_G	1.057	0.77
70_F	91_M	1.051	0.76
73_E	84_K	1.045	0.76
66_M	108_M	1.043	0.76
42_G	54_I	1.035	0.75
85_G	107_E	1.031	0.74
40_V	133_Y	1.027	0.74
47_S	96_P	1.015	0.73
31_Q	54_I	1.01	0.72
108_M	112_G	1.003	0.72
64_G	70_F	1.002	0.71

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2ktsA	1	0.8357	100	0.231	Contact Map	0.411
2la7A	1	0.9286	99.9	0.325	Contact Map	0.409
4l3rA	2	0.8	85.4	0.87	Contact Map	0.467
2yp6A	4	0.9571	62.5	0.893	Contact Map	0.138
3zbiC	14	0.3429	61.8	0.893	Contact Map	0
1sluA	1	0.8143	58.3	0.895	Contact Map	0.245
2y6tE	4	0.8786	48.2	0.901	Contact Map	0.261
4fybB	2	0.9214	47.4	0.902	Contact Map	0.251
2hyxA	4	0.95	32.7	0.911	Contact Map	0.145
2m4lA	1	0.6643	18.8	0.92	Contact Map	0.344

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 1.3022 seconds.