OPENSEQ.org - YFJY - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YFJY - UPF0758 protein YfjY

UniProt:	P52140	Sequence MMEQSLIPQTPVLPLTAQRTVKRALTLLDRHLRETGVAFTSTQAARDWLKLKMAGLEREEFMMLYLNQQNQLIAHETLFAGSISSTEVHPREVVKRALYFNAAAVILAHNHPSGDTTPSQADKTITQRLVQALQLVDIRVPDHLIVGGRQIYSFAEHGLL	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13211
Length:	160 (145)
Sequences:	1795
Seq/Len:	12.38

YFJY
Paralog alert: 0.27 [within 20: 0.01] - ratio of genomes with paralogs
Cluster includes: YEES YFJY YICR YKFG

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
107_L	140_V	2.926	1.00
152_Y	157_H	2.614	1.00
67_N	71_Q	2.57	1.00
94_V	133_L	2.555	1.00
76_E	96_R	2.554	1.00
123_K	154_F	2.444	1.00
49_L	108_A	2.444	1.00
83_I	103_A	2.142	1.00
39_F	72_L	2.026	1.00
123_K	159_L	2.012	1.00
107_L	129_L	1.963	1.00
58_R	80_A	1.915	1.00
53_M	56_L	1.884	1.00
130_V	140_V	1.827	1.00
127_Q	131_Q	1.776	1.00
68_Q	84_S	1.769	1.00
120_Q	124_T	1.743	1.00
93_V	129_L	1.661	1.00
40_T	44_A	1.649	1.00
65_Y	96_R	1.633	1.00
95_K	101_N	1.629	1.00
62_M	77_T	1.603	1.00
77_T	80_A	1.597	1.00
74_A	100_F	1.592	1.00
64_L	72_L	1.578	1.00
62_M	75_H	1.557	1.00
57_E	95_K	1.552	1.00
126_T	143_H	1.531	1.00
22_K	26_T	1.508	1.00
94_V	136_V	1.506	1.00
42_T	156_E	1.501	1.00
60_E	77_T	1.497	1.00
131_Q	134_Q	1.465	1.00
97_A	105_V	1.459	1.00
43_Q	47_D	1.452	1.00
120_Q	123_K	1.45	1.00
65_Y	100_F	1.444	1.00
61_F	140_V	1.43	1.00
116_T	150_Q	1.408	1.00
97_A	138_I	1.382	0.99
58_R	79_F	1.382	0.99
53_M	62_M	1.376	0.99
96_R	99_Y	1.367	0.99
96_R	100_F	1.367	0.99
79_F	86_T	1.364	0.99
88_V	125_I	1.354	0.99
54_A	148_G	1.35	0.99
69_Q	115_D	1.317	0.99
145_I	152_Y	1.3	0.99
56_L	60_E	1.291	0.99
116_T	152_Y	1.288	0.99
26_T	30_R	1.274	0.99
65_Y	76_E	1.271	0.99
154_F	159_L	1.271	0.99
154_F	160_L	1.271	0.99
61_F	88_V	1.268	0.99
60_E	80_A	1.242	0.98
70_N	104_A	1.232	0.98
117_T	157_H	1.201	0.98
52_K	75_H	1.199	0.98
23_R	27_L	1.195	0.98
132_A	136_V	1.172	0.98
39_F	45_A	1.151	0.97
130_V	134_Q	1.146	0.97
152_Y	159_L	1.108	0.96
65_Y	97_A	1.104	0.96
82_S	92_E	1.097	0.96
54_A	147_G	1.071	0.95
64_L	75_H	1.062	0.95
144_L	151_I	1.05	0.94
82_S	89_H	1.049	0.94
130_V	160_L	1.049	0.94
19_R	26_T	1.034	0.94
56_L	77_T	1.023	0.93
23_R	26_T	1.018	0.93
43_Q	156_E	1.015	0.93
46_R	144_L	1.012	0.93
16_T	19_R	1.012	0.93
47_D	50_K	1.011	0.93
70_N	141_P	1.008	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2qlcA	8	0.7875	100	0.193	Contact Map	0.835
1oi0A	4	0.6813	85.5	0.908	Contact Map	0.393
2kcqA	1	0.7063	83.4	0.91	Contact Map	0.356
2kksA	1	0.7063	77	0.916	Contact Map	0.2
3k13A	3	0.9875	69.2	0.921	Contact Map	0.324
3oqpA	2	0.6125	55.7	0.927	Contact Map	0.063
4f7oA	2	0.9625	47.9	0.93	Contact Map	0.221
4h17A	2	0.7063	47.4	0.931	Contact Map	0.064
2znrA	1	0.825	38.5	0.934	Contact Map	0.42
3rzvA	1	0.9625	38.2	0.934	Contact Map	0.36

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.1707 seconds.