OPENSEQ.org - RATB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

RATB - UPF0125 protein RatB

UniProt:	P52119	Sequence MPGKIAVEVAYALPEKQYLQRVTLQEGATVEEAIRASGLLELRTDIDLTKNKVGIYSRPAKLSDSVHDGDRVEIYRPLIADPKELRRQRAEKSANK	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG13192
Length:	96 (94)
Sequences:	458
Seq/Len:	4.87

RATB
Paralog alert: 0.02 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
30_V	60_A	3.015	1.00
30_V	53_V	2.768	1.00
34_I	53_V	2.272	1.00
31_E	35_R	2.078	1.00
33_A	66_V	2.018	1.00
84_E	88_Q	1.791	1.00
24_L	28_A	1.772	1.00
53_V	62_L	1.725	1.00
20_Q	39_L	1.671	0.99
28_A	36_A	1.607	0.99
84_E	87_R	1.601	0.99
54_G	75_Y	1.538	0.99
6_A	23_T	1.534	0.99
18_Y	42_L	1.449	0.98
67_H	70_D	1.448	0.98
11_Y	17_Q	1.35	0.96
86_R	89_R	1.346	0.96
40_L	46_I	1.337	0.96
31_E	62_L	1.326	0.96
34_I	62_L	1.312	0.96
30_V	72_V	1.3	0.95
5_I	26_E	1.27	0.94
87_R	91_E	1.264	0.94
34_I	40_L	1.241	0.93
78_L	90_A	1.231	0.93
18_Y	43_R	1.23	0.93
83_K	86_R	1.221	0.93
34_I	72_V	1.175	0.91
27_G	33_A	1.163	0.90
39_L	74_I	1.161	0.90
78_L	86_R	1.153	0.90
28_A	83_K	1.141	0.89
78_L	83_K	1.134	0.89
52_K	61_K	1.131	0.88
56_Y	79_I	1.129	0.88
30_V	34_I	1.09	0.86
22_V	28_A	1.088	0.86
47_D	50_K	1.087	0.86
8_E	19_L	1.075	0.85
25_Q	36_A	1.065	0.84
90_A	94_A	1.047	0.83
66_V	72_V	1.043	0.82
8_E	78_L	1.03	0.81
7_V	72_V	1.029	0.81
8_E	86_R	1.025	0.81
86_R	90_A	1.022	0.80
11_Y	48_L	1.011	0.79
32_E	65_S	1.006	0.79
13_L	45_D	1.004	0.79

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2hj1A	2	0.9271	99.8	0.475	Contact Map	0.77
1ryjA	1	0.7292	98.6	0.725	Contact Map	0.48
4hroA	2	0.7917	98.2	0.75	Contact Map	0.6
2q5wD	1	0.7604	98.2	0.754	Contact Map	0.632
3hvzA	6	0.7812	98.1	0.762	Contact Map	0.606
1vjkA	1	0.8229	98	0.765	Contact Map	0.567
2l32A	1	0.7604	98	0.765	Contact Map	0.121
3po0A	1	0.7812	97.7	0.78	Contact Map	0.535
1rwsA	1	0.7083	97.3	0.795	Contact Map	0.021
1f0zA	1	0.6458	97	0.806	Contact Map	0.45

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.9437 seconds.