OPENSEQ.org - YECH - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YECH - Uncharacterized protein YecH

UniProt:	P46887	Sequence MDSIHGHEVLNMMIESGEQYTHASLEAAIKARFGEQARFHTCSAEGMTAGELVAFLAAKGKFIPSKDGFSTDQSKICRH	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12863
Length:	79 (79)
Sequences:	88
Seq/Len:	1.11

YECH
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
1_M	10_L	2.362	0.99
29_I	39_F	1.885	0.94
50_G	65_S	1.853	0.94
48_T	58_A	1.846	0.94
41_T	49_A	1.608	0.85
26_E	49_A	1.592	0.85
9_V	52_L	1.509	0.80
3_S	6_G	1.453	0.76
39_F	69_F	1.434	0.75
40_H	76_I	1.433	0.75
17_G	55_F	1.37	0.70
29_I	69_F	1.352	0.69
12_M	28_A	1.343	0.68
40_H	73_Q	1.311	0.65
15_E	19_Q	1.308	0.65
6_G	49_A	1.294	0.64
11_N	16_S	1.291	0.63
1_M	8_E	1.278	0.62
51_E	54_A	1.261	0.61
26_E	53_V	1.252	0.60
14_I	74_S	1.228	0.58
35_E	41_T	1.225	0.57
3_S	71_T	1.22	0.57
40_H	63_I	1.174	0.53
2_D	59_K	1.172	0.52
8_E	40_H	1.122	0.48
65_S	74_S	1.114	0.47
14_I	71_T	1.107	0.46
71_T	76_I	1.104	0.46
31_A	66_K	1.097	0.45
58_A	67_D	1.088	0.44
5_H	9_V	1.084	0.44
69_F	75_K	1.048	0.41
63_I	71_T	1.045	0.40
32_R	68_G	1.041	0.40
31_A	51_E	1.036	0.40
2_D	40_H	1.034	0.39
2_D	8_E	1.033	0.39
38_R	41_T	1.027	0.39
9_V	44_A	1.026	0.39
30_K	59_K	1.025	0.39
14_I	17_G	1.017	0.38
12_M	69_F	1.015	0.38
28_A	69_F	1.014	0.38
20_Y	39_F	1.01	0.37

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results:

PDB	Chains	Cov	P(%)	HHΔ		Acc
1zavA	1	0.8228	22.4	0.922	Contact Map	0.053
3iz5s	1	0.8608	21.6	0.922	Contact Map	0.045
1ucdA	1	0.8987	20.9	0.923	Contact Map	0.082
3htxA	2	0.8481	15.4	0.927	Contact Map	0.044
1iqqA	1	1	13.5	0.929	Contact Map	0.058
1bolA	1	0.9114	12.6	0.93	Contact Map	0.05
4l6wA	2	0.8481	12.1	0.93	Contact Map	0.147
3dtzA	5	0.5949	12.1	0.931	Contact Map	0.022
2pqxA	1	0.9241	11.9	0.931	Contact Map	0.052
1sglA	1	0.8987	11.7	0.931	Contact Map	0.067

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.1965 seconds.