OPENSEQ.org - TUSC - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

TUSC - Protein TusC

UniProt:	P45531	Sequence MKRIAFVFSTAPHGTAAGREGLDALLATSALTDDLAVFFIADGVFQLLPGQKPDAVLARDYIATFKLLGLYDIEQCWVCAASLRERGLDPQTPFVVEATPLEADALRRELANYDVILRF	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12897
Length:	119 (119)
Sequences:	297
Seq/Len:	2.50

TUSC
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
25_L	37_V	2.705	1.00
42_D	86_R	2.688	1.00
102_E	105_A	2.103	1.00
18_G	61_Y	1.876	0.99
80_A	84_R	1.796	0.98
5_A	38_F	1.757	0.98
36_A	113_Y	1.73	0.98
8_F	21_G	1.717	0.98
81_A	103_A	1.674	0.97
80_A	90_P	1.604	0.96
32_T	59_R	1.483	0.93
4_I	28_T	1.462	0.93
4_I	40_I	1.461	0.93
46_Q	114_D	1.442	0.92
22_L	68_L	1.384	0.90
19_R	70_L	1.363	0.89
79_C	82_S	1.311	0.86
105_A	108_R	1.29	0.85
27_A	30_A	1.284	0.85
78_V	83_L	1.272	0.84
90_P	100_P	1.27	0.84
8_F	39_F	1.263	0.83
96_V	118_R	1.262	0.83
47_L	73_I	1.253	0.83
19_R	23_D	1.252	0.83
85_E	103_A	1.247	0.82
83_L	94_F	1.244	0.82
24_A	119_F	1.243	0.82
45_F	86_R	1.205	0.79
9_S	41_A	1.202	0.79
41_A	78_V	1.198	0.79
29_S	33_D	1.177	0.77
14_G	68_L	1.152	0.75
11_A	56_V	1.151	0.75
6_F	25_L	1.143	0.74
4_I	31_L	1.13	0.73
41_A	82_S	1.129	0.73
101_L	109_E	1.125	0.72
46_Q	61_Y	1.119	0.72
25_L	48_L	1.119	0.72
29_S	57_L	1.118	0.72
46_Q	86_R	1.109	0.71
78_V	94_F	1.101	0.70
13_H	65_F	1.094	0.69
50_G	80_A	1.089	0.69
82_S	87_G	1.086	0.68
5_A	65_F	1.073	0.67
9_S	94_F	1.073	0.67
74_E	98_A	1.071	0.67
24_A	27_A	1.058	0.66
96_V	100_P	1.058	0.66
70_L	76_C	1.057	0.65
109_E	112_N	1.05	0.65
108_R	111_A	1.049	0.65
18_G	46_Q	1.038	0.63
7_V	110_L	1.036	0.63
101_L	105_A	1.032	0.63
6_F	59_R	1.029	0.62
13_H	18_G	1.025	0.62
14_G	56_V	1.023	0.62
76_C	96_V	1.015	0.61
34_D	75_Q	1.012	0.60
24_A	29_S	1.008	0.60
9_S	76_C	1.007	0.60
10_T	66_K	1.002	0.59
25_L	57_L	1	0.59

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2hy5B	1	0.9916	100	0.425	Contact Map	0.491
2d1pB	3	1	99.9	0.427	Contact Map	0.522
2d1pA	3	0.9664	99.9	0.456	Contact Map	0.377
2hy5A	1	0.9748	99.9	0.499	Contact Map	0.398
1jx7A	6	0.9664	99.9	0.528	Contact Map	0.484
2d1pC	3	0.7983	99.8	0.551	Contact Map	0.529
2hy5C	1	0.8487	99.8	0.578	Contact Map	0.579
3mc3A	1	0.9748	99.7	0.594	Contact Map	0.473
3pnxA	6	0.958	99.5	0.654	Contact Map	0.54
1x9aA	2	0.7311	99.3	0.694	Contact Map	0.506

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.5532 seconds.