OPENSEQ.org - TUSB - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

TUSB - Protein TusB

UniProt:	P45530	Sequence MLHTLHRSPWLTDFAALLRLLSEGDELLLLQDGVTAAVDGNRYLESLRNAPIKVYALNEDLIARGLTGQISNDIILIDYTDFVRLTVKHPSQMAW	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12896
Length:	95 (95)
Sequences:	273
Seq/Len:	2.87

TUSB
Paralog alert: 0.00 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
61_L	76_L	2.403	1.00
4_T	94_A	2.379	1.00
78_D	81_D	2.07	1.00
56_A	74_I	2.048	1.00
26_E	89_H	1.824	0.99
58_N	62_I	1.785	0.99
28_L	54_V	1.66	0.98
56_A	61_L	1.609	0.97
6_H	31_Q	1.599	0.97
28_L	56_A	1.459	0.94
15_A	46_S	1.455	0.94
25_D	93_M	1.445	0.94
29_L	37_A	1.411	0.93
5_L	27_L	1.392	0.92
4_T	33_G	1.37	0.91
17_L	31_Q	1.364	0.91
59_E	78_D	1.345	0.90
21_L	27_L	1.341	0.90
58_N	76_L	1.304	0.88
37_A	70_I	1.302	0.88
26_E	88_K	1.287	0.88
1_M	92_Q	1.279	0.87
53_K	61_L	1.273	0.87
9_P	36_A	1.266	0.86
24_G	51_P	1.259	0.86
13_D	71_S	1.247	0.85
55_Y	77_I	1.225	0.84
5_L	17_L	1.223	0.84
23_E	34_V	1.221	0.84
4_T	92_Q	1.214	0.83
56_A	94_A	1.201	0.82
55_Y	75_I	1.199	0.82
34_V	65_G	1.191	0.82
8_S	79_Y	1.156	0.79
80_T	92_Q	1.138	0.77
14_F	29_L	1.129	0.76
10_W	35_T	1.121	0.76
14_F	74_I	1.109	0.75
57_L	79_Y	1.104	0.74
11_L	89_H	1.096	0.73
4_T	30_L	1.095	0.73
1_M	26_E	1.092	0.73
84_R	88_K	1.076	0.71
3_H	95_W	1.073	0.71
41_N	47_L	1.057	0.70
28_L	82_F	1.036	0.67
53_K	75_I	1.008	0.64
44_L	48_R	1.002	0.64

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2d1pC	3	1	99.9	0.265	Contact Map	0.62
1x9aA	2	0.9053	99.9	0.279	Contact Map	0.411
1rhxA	1	0.9053	99.9	0.287	Contact Map	0.398
2hy5C	1	1	99.8	0.43	Contact Map	0.647
2d1pB	3	1	99.5	0.518	Contact Map	0.478
1jx7A	6	1	99.1	0.611	Contact Map	0.515
2hy5B	1	1	99.1	0.622	Contact Map	0.559
2hy5A	1	1	98.5	0.693	Contact Map	0.529
3mc3A	1	1	98	0.731	Contact Map	0.534
2d1pA	3	1	97.6	0.751	Contact Map	0.495

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.2164 seconds.