OPENSEQ.org - PTPB1 - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

PTPB1 - N-acetylgalactosamine-specific phosphotransferase enzyme IIB component 1

UniProt:	P42909	Sequence MTSPNILLTRIDNRLVHGQVGVTWTSTIGANLLVVVDDVVANDDIQQKLMGITAETYGFGIRFFTIEKTINVIGKAAPHQKIFLICRTPQTVRKLVEGGIDLKDVNVGNMHFSEGKKQISSKVYVDDQDLTDLRFIKQRGVNVFIQDVPGDQKEQIPD	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12769
Length:	158 (153)
Sequences:	899
Seq/Len:	5.88

PTPB1
Paralog alert: 0.84 [within 20: 0.20] - ratio of genomes with paralogs
Cluster includes: PTPB1 PTPB2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
37_D	91_T	4.655	1.00
97_E	135_F	3.74	1.00
70_I	98_G	3.4	1.00
92_V	105_V	2.819	1.00
127_D	131_T	2.598	1.00
86_C	92_V	2.279	1.00
142_N	153_K	2.263	1.00
104_D	142_N	2.186	1.00
96_V	136_I	2.178	1.00
93_R	135_F	2.152	1.00
97_E	139_R	2.132	1.00
66_I	94_K	2.069	1.00
25_T	59_F	2.032	1.00
67_E	71_N	1.993	1.00
38_D	94_K	1.992	1.00
46_Q	87_R	1.875	1.00
93_R	97_E	1.802	1.00
29_G	81_K	1.801	1.00
30_A	83_F	1.778	1.00
119_I	125_V	1.755	1.00
54_A	61_I	1.695	1.00
93_R	132_D	1.58	0.99
41_A	65_T	1.564	0.99
86_C	95_L	1.556	0.99
117_K	130_L	1.55	0.99
37_D	87_R	1.546	0.99
117_K	127_D	1.53	0.99
131_T	135_F	1.528	0.99
11_I	133_L	1.492	0.99
67_E	94_K	1.492	0.99
7_L	28_I	1.48	0.99
107_V	133_L	1.461	0.99
135_F	138_Q	1.453	0.99
90_Q	128_Q	1.421	0.98
94_K	97_E	1.412	0.98
90_Q	132_D	1.389	0.98
135_F	139_R	1.382	0.98
89_P	110_M	1.377	0.98
134_R	138_Q	1.372	0.98
11_I	89_P	1.371	0.98
9_T	92_V	1.353	0.98
96_V	102_L	1.335	0.97
11_I	107_V	1.321	0.97
128_Q	131_T	1.284	0.96
109_N	122_K	1.284	0.96
68_K	71_N	1.269	0.96
104_D	153_K	1.229	0.95
32_L	62_R	1.229	0.95
40_V	106_N	1.217	0.95
9_T	84_L	1.212	0.95
146_Q	149_P	1.212	0.95
36_V	69_T	1.198	0.94
113_S	116_K	1.191	0.94
94_K	98_G	1.185	0.94
104_D	144_F	1.183	0.94
116_K	126_D	1.181	0.93
128_Q	132_D	1.179	0.93
7_L	81_K	1.164	0.93
44_D	47_Q	1.16	0.93
13_N	109_N	1.154	0.92
137_K	157_P	1.152	0.92
66_I	91_T	1.129	0.91
65_T	68_K	1.124	0.91
89_P	132_D	1.12	0.91
13_N	111_H	1.103	0.90
89_P	133_L	1.076	0.88
9_T	102_L	1.07	0.88
40_V	46_Q	1.068	0.88
43_D	46_Q	1.067	0.88
107_V	145_I	1.066	0.88
42_N	65_T	1.065	0.88
32_L	80_Q	1.064	0.88
7_L	30_A	1.061	0.88
33_L	85_I	1.056	0.87
93_R	139_R	1.045	0.86
110_M	125_V	1.027	0.85
118_Q	124_Y	1.026	0.85
23_T	149_P	1.01	0.84

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3lfjA	2	0.9937	100	0.014	Contact Map	0.677
1bleA	1	0.981	100	0.014	Contact Map	0.731
1nrzA	4	0.9747	100	0.023	Contact Map	0.799
3eyeA	1	1	100	0.023	Contact Map	0.762
1vsqC	1	0.9937	100	0.024	Contact Map	0.613
3p3vA	2	0.9873	100	0.049	Contact Map	0.743
2wk1A	1	0.481	16	0.944	Contact Map	0.198
2ps1A	2	0.7975	14.3	0.945	Contact Map	0.317
4dyjA	2	0.9177	12.7	0.946	Contact Map	0.198
3co8A	2	0.8354	11.5	0.947	Contact Map	0.264

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.1344 seconds.