OPENSEQ.org - AGAA - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

AGAA - Putative N-acetylgalactosamine-6-phosphate deacetylase

UniProt:	P42906	Sequence MHCYNGMTGLHHREPGMVGAGLTDKRAWLELIADGHHVHPAAMSLCCCCAKERIVLITDAMQAAGMPDGRYTLCGEEVQMHGGVVRTASGGLAGSTLSVDAAVRNMVELTGVTPAEAIHMASLHPARMLGVDGVLGSLKPGKRASVVALDSGLHVQQIWIQGQLASF	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12766
Length:	167 (164)
Sequences:	1340
Seq/Len:	8.17

AGAA
Paralog alert: 0.28 [within 20: 0.01] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
97_L	102_A	3.681	1.00
135_L	143_R	3.572	1.00
137_S	142_K	3.435	1.00
150_D	154_H	3.158	1.00
138_L	146_V	2.944	1.00
3_C	46_C	2.431	1.00
103_V	121_A	2.285	1.00
10_L	19_G	2.217	1.00
70_R	77_E	2.157	1.00
33_A	43_M	2.052	1.00
56_L	121_A	2.007	1.00
58_T	99_V	1.977	1.00
98_S	101_A	1.932	1.00
159_W	164_L	1.816	1.00
157_Q	164_L	1.792	1.00
50_A	53_R	1.771	1.00
8_T	14_E	1.766	1.00
80_M	85_V	1.764	1.00
6_G	91_G	1.759	1.00
21_G	29_L	1.743	1.00
123_L	132_D	1.71	1.00
31_L	54_I	1.649	1.00
47_C	120_M	1.624	1.00
150_D	156_Q	1.612	1.00
118_I	122_S	1.6	1.00
100_D	104_R	1.551	1.00
10_L	42_A	1.533	1.00
149_L	153_L	1.527	1.00
105_N	109_L	1.518	1.00
33_A	106_M	1.51	1.00
12_H	42_A	1.507	1.00
147_V	155_V	1.469	0.99
139_K	142_K	1.469	0.99
107_V	117_A	1.411	0.99
63_A	80_M	1.407	0.99
23_T	44_S	1.404	0.99
72_T	75_G	1.397	0.99
52_E	119_H	1.384	0.99
134_V	143_R	1.378	0.99
63_A	74_C	1.362	0.99
33_A	56_L	1.337	0.99
102_A	106_M	1.336	0.99
127_R	137_S	1.308	0.98
55_V	124_H	1.308	0.98
119_H	123_L	1.283	0.98
70_R	79_Q	1.282	0.98
38_V	42_A	1.271	0.98
113_T	116_E	1.269	0.98
104_R	154_H	1.259	0.98
31_L	43_M	1.254	0.98
61_M	73_L	1.232	0.97
4_Y	42_A	1.219	0.97
11_H	14_E	1.193	0.97
143_R	161_Q	1.183	0.97
72_T	77_E	1.182	0.96
29_L	50_A	1.181	0.96
55_V	128_M	1.18	0.96
3_C	29_L	1.164	0.96
8_T	17_M	1.16	0.96
123_L	127_R	1.16	0.96
60_A	64_A	1.159	0.96
66_M	69_G	1.148	0.96
21_G	50_A	1.147	0.96
22_L	49_C	1.145	0.96
114_P	153_L	1.125	0.95
4_Y	46_C	1.117	0.95
47_C	54_I	1.111	0.95
131_V	135_L	1.095	0.94
127_R	132_D	1.088	0.94
30_E	57_I	1.08	0.93
25_K	48_C	1.078	0.93
35_G	109_L	1.075	0.93
23_T	45_L	1.073	0.93
121_A	125_P	1.07	0.93
58_T	97_L	1.064	0.93
22_L	50_A	1.058	0.92
84_V	92_L	1.056	0.92
147_V	158_I	1.056	0.92
63_A	73_L	1.055	0.92
29_L	46_C	1.052	0.92
36_H	84_V	1.044	0.92
13_R	16_G	1.037	0.91
15_P	39_H	1.036	0.91
135_L	145_S	1.031	0.91
58_T	98_S	1.019	0.91
23_T	49_C	1.009	0.90
3_C	21_G	1.008	0.90

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
3iv8A	4	1	100	0.399	Contact Map	0.863
1yrrA	2	1	100	0.405	Contact Map	0.839
2vhlA	2	1	100	0.418	Contact Map	0.795
1o12A	2	0.994	100	0.462	Contact Map	0.813
3gipA	2	0.9701	99.9	0.618	Contact Map	0.394
1onwA	2	0.8862	99.9	0.633	Contact Map	0.664
2ftwA	1	0.9461	99.9	0.636	Contact Map	0.426
2vr2A	1	0.9701	99.8	0.653	Contact Map	0.476
2vm8A	4	0.9701	99.8	0.663	Contact Map	0.557
3dc8A	2	0.9401	99.8	0.666	Contact Map	0.544

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.6659 seconds.