OPENSEQ.org - YCHJ - ECOLI GREMLIN

May 4, 2021 - We are working on upgrading the webserver, some pages may not work.

YCHJ - UPF0225 protein YchJ

UniProt:	P37052	Sequence MSQLCPCGSAVEYSLCCHPYVSGEKVAPDPEHLMRSRYCAFVMQDADYLIKTWHPSCGAAALRAELMAGFAHTEWLGLTVFEHCWQDADNIGFVSFVARFTEGGKTGAIIERSRFLKENGQWYYIDGTRPQFGRNDPCPCGSGKKFKKCCGQ	Download Alignment We filter this alignment to remove sites that have > 75% gaps before running GREMLIN.
EcoGene:	EG12119
Length:	152 (152)
Sequences:	698
Seq/Len:	4.59

YCHJ
Paralog alert: 0.01 [within 20: 0.00] - ratio of genomes with paralogs

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Scaled Score	Prob
95_S	110_I	4.37	1.00
13_Y	21_V	3.761	1.00
36_S	48_Y	3.564	1.00
28_P	32_H	3.547	1.00
20_Y	27_A	2.946	1.00
21_V	39_C	2.638	1.00
20_Y	28_P	2.627	1.00
114_R	126_D	2.269	1.00
81_F	97_V	2.269	1.00
56_S	118_E	2.245	1.00
13_Y	43_M	2.041	1.00
77_G	99_R	2.02	1.00
18_H	22_S	2.002	1.00
96_F	113_S	1.869	1.00
38_Y	77_G	1.847	1.00
93_F	112_R	1.805	1.00
109_I	124_Y	1.773	1.00
82_E	112_R	1.771	1.00
30_P	92_G	1.77	1.00
20_Y	32_H	1.764	1.00
20_Y	52_T	1.716	0.99
21_V	45_D	1.656	0.99
20_Y	48_Y	1.651	0.99
53_W	124_Y	1.562	0.99
22_S	45_D	1.529	0.98
136_D	148_K	1.509	0.98
84_C	93_F	1.453	0.98
34_M	94_V	1.407	0.97
50_I	58_G	1.377	0.96
81_F	95_S	1.37	0.96
41_F	49_L	1.365	0.96
14_S	18_H	1.365	0.96
85_W	89_D	1.363	0.96
97_V	108_A	1.361	0.96
133_G	136_D	1.338	0.96
29_D	32_H	1.328	0.95
55_P	118_E	1.328	0.95
95_S	112_R	1.312	0.95
38_Y	42_V	1.294	0.94
49_L	53_W	1.293	0.94
73_T	109_I	1.285	0.94
102_E	105_K	1.276	0.94
38_Y	99_R	1.253	0.93
81_F	110_I	1.249	0.93
6_P	13_Y	1.23	0.92
137_P	143_G	1.23	0.92
83_H	92_G	1.212	0.92
29_D	92_G	1.179	0.90
88_A	91_I	1.167	0.89
58_G	62_L	1.154	0.89
83_H	86_Q	1.148	0.88
54_H	116_L	1.145	0.88
69_G	109_I	1.14	0.88
62_L	65_E	1.121	0.87
134_R	148_K	1.119	0.87
79_T	97_V	1.109	0.86
31_E	83_H	1.108	0.86
29_D	83_H	1.09	0.85
47_D	63_R	1.08	0.84
53_W	59_A	1.076	0.84
53_W	109_I	1.067	0.83
132_F	139_P	1.067	0.83
65_E	68_A	1.051	0.82
56_S	116_L	1.045	0.81
90_N	117_K	1.041	0.81
87_D	91_I	1.03	0.80
82_E	95_S	1.027	0.79
97_V	110_I	1.026	0.79
62_L	66_L	1.013	0.78
124_Y	127_G	1.005	0.77

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Scaled Score = (raw_score/average(raw_scores)) > 1 are listed. For all 3L/2 predictions, click on one of the links below.

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling

HHsearch Results: GREMLIN results overlayed on top 10 PDB hits:

Legend: Blue filled circles are GREMLIN results (Scaled_score >1). The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on 10 HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	P(%)	HHΔ		Acc
2i9wA	1	1	100	0.063	Contact Map	0.719
2jq5A	1	0.8355	100	0.271	Contact Map	0.599
1tf5A	1	0.8947	99	0.819	Contact Map	0.048
1ozbI	2	0.1447	98.4	0.856	Contact Map	0.384
2ipcA	4	0.8553	97.5	0.883	Contact Map	0.089
2r4iA	4	0.7303	80	0.933	Contact Map	0.454
3kspA	1	0.7434	77.3	0.935	Contact Map	0.439
3ke7A	2	0.7368	76.8	0.935	Contact Map	0.417
3hx8A	4	0.7171	64.5	0.941	Contact Map	0.45
3b7cA	1	0.7039	60.3	0.942	Contact Map	0.439

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 1.3533 seconds.